Active GMP Recombinant Mouse Cxcl16 Protein, His-Tagged

• Cat.No.: Cxcl16-01M
• Product Overview: GMP Recombinant Mouse Cxcl16 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Enables chemokine activity; low-density lipoprotein particle receptor activity; and scavenger receptor activity. Involved in T cell chemotaxis and cellular response to lipopolysaccharide. Located in extracellular space. Is integral component of membrane. Is expressed in bladder; female associated reproductive structure; hindbrain meninges; male associated reproductive structure; and spinal cord meninges. Orthologous to human CXCL16 (C-X-C motif chemokine ligand 16).
• Form: Lyophilized
• Bio-activity: Measure by its ability to chemoattract BaF3 cells transfected with mouse CXCR6. The ED50 for this effect is <3 ng/mL.
• AA Sequence: NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: Cxcl16 chemokine (C-X-C motif) ligand 16 [ Mus musculus (house mouse) ]
• Official Symbol: Cxcl16
• Synonyms: SR-PSOX; Zmynd15; CXCL16v1; CXCL16v2; b2b498Clo; 0910001K24Rik
• Gene ID: 66102
• mRNA Refseq: NM_023158.7
• Protein Refseq: NP_075647.3
• UniProt ID: Q8BSU2