Active GMP Recombinant Mouse Cxcl16 Protein, His-Tagged
Cat.No. : | Cxcl16-01M |
Product Overview : | GMP Recombinant Mouse Cxcl16 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Enables chemokine activity; low-density lipoprotein particle receptor activity; and scavenger receptor activity. Involved in T cell chemotaxis and cellular response to lipopolysaccharide. Located in extracellular space. Is integral component of membrane. Is expressed in bladder; female associated reproductive structure; hindbrain meninges; male associated reproductive structure; and spinal cord meninges. Orthologous to human CXCL16 (C-X-C motif chemokine ligand 16). |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to chemoattract BaF3 cells transfected with mouse CXCR6. The ED50 for this effect is <3 ng/mL. |
AA Sequence : | NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP with polyhistidine tag at the N-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | Cxcl16 chemokine (C-X-C motif) ligand 16 [ Mus musculus (house mouse) ] |
Official Symbol | Cxcl16 |
Synonyms | SR-PSOX; Zmynd15; CXCL16v1; CXCL16v2; b2b498Clo; 0910001K24Rik |
Gene ID | 66102 |
mRNA Refseq | NM_023158.7 |
Protein Refseq | NP_075647.3 |
UniProt ID | Q8BSU2 |
◆ Recombinant Proteins | ||
Cxcl16-284M | Active Recombinant Mouse Cxcl16 Protein (Asn27-Pro114), N-His tagged, Animal-free, Carrier-free | +Inquiry |
Cxcl16-7649M | Recombinant Mouse Cxcl16 protein, His & T7-tagged | +Inquiry |
CXCL16-2182H | Recombinant Human CXCL16 Protein (Pro49-Pro137), N-GST tagged | +Inquiry |
Cxcl16-7650R | Recombinant Rat Cxcl16 protein, His & T7-tagged | +Inquiry |
CXCL16-1084R | Recombinant Rat C-X-C motif chemokine ligand 16 Protein, His&SUMO tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL16-842CCL | Recombinant Canine CXCL16 cell lysate | +Inquiry |
CXCL16-2545MCL | Recombinant Mouse CXCL16 cell lysate | +Inquiry |
CXCL16-1414RCL | Recombinant Rat CXCL16 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl16 Products
Required fields are marked with *
My Review for All Cxcl16 Products
Required fields are marked with *
0
Inquiry Basket