Active GMP Recombinant Mouse Cxcl16 Protein, His-Tagged

Cat.No. : Cxcl16-01M
Product Overview : GMP Recombinant Mouse Cxcl16 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Enables chemokine activity; low-density lipoprotein particle receptor activity; and scavenger receptor activity. Involved in T cell chemotaxis and cellular response to lipopolysaccharide. Located in extracellular space. Is integral component of membrane. Is expressed in bladder; female associated reproductive structure; hindbrain meninges; male associated reproductive structure; and spinal cord meninges. Orthologous to human CXCL16 (C-X-C motif chemokine ligand 16).
Form : Lyophilized
Bio-activity : Measure by its ability to chemoattract BaF3 cells transfected with mouse CXCR6. The ED50 for this effect is <3 ng/mL.
AA Sequence : NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name Cxcl16 chemokine (C-X-C motif) ligand 16 [ Mus musculus (house mouse) ]
Official Symbol Cxcl16
Synonyms SR-PSOX; Zmynd15; CXCL16v1; CXCL16v2; b2b498Clo; 0910001K24Rik
Gene ID 66102
mRNA Refseq NM_023158.7
Protein Refseq NP_075647.3
UniProt ID Q8BSU2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl16 Products

Required fields are marked with *

My Review for All Cxcl16 Products

Required fields are marked with *

0
cart-icon
0
compare icon