Active Recombinant Dog IL1A Protein, His-tagged

Cat.No. : IL1A-011D
Product Overview : Recombinant canine IL-1 alpha /IL-1F1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : Insect cells
Tag : His
Description : Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Form : Liquid
Bio-activity : Measured in a cell proliferation assay using D10.G4.1 mouse helper T cell. The ED50 range ≤ 2 ng/mL.
Molecular Mass : 19.3 kDa
AA Sequence : SVAYNFHNNEKYNYIRIIKSQFILNDNLNQSIVRQTGGNYLMTAALQNLDDAVKFDMGAYTSEDSKLPVTLRISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGSKHYFKSVAQPKLFIATQERKLVHMARGQPSITDFRLLETQP
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -90 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name IL1A interleukin 1 alpha [ Canis lupus familiaris (dog) ]
Official Symbol IL1A
Synonyms IL1A; interleukin 1 alpha; interleukin-1 alpha; IL-1 alpha
Gene ID 403782
mRNA Refseq NM_001003157
Protein Refseq NP_001003157
UniProt ID O46612

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL1A Products

Required fields are marked with *

My Review for All IL1A Products

Required fields are marked with *

0
cart-icon