Active Recombinant Full Length Human RNASE1 Protein, C-Flag-tagged
| Cat.No. : | RNASE1-02HFL |
| Product Overview : | Recombinant Full Length Human RNASE1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Bio-activity : | Enzyme activity In vivo treatment Cell treatment Binding assay In vivo treatment |
| Molecular Mass : | 14.5 kDa |
| AA Sequence : | MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKP VNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEG SPYVPVHFDASVEDSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Secreted Protein, Transmembrane |
| Full Length : | Full L. |
| Gene Name | RNASE1 ribonuclease A family member 1, pancreatic [ Homo sapiens (human) ] |
| Official Symbol | RNASE1 |
| Synonyms | RAC1; RIB1; RNS1 |
| Gene ID | 6035 |
| mRNA Refseq | NM_198235.3 |
| Protein Refseq | NP_937878.1 |
| MIM | 180440 |
| UniProt ID | P07998 |
| ◆ Recombinant Proteins | ||
| RNASE1-3424H | Recombinant Human RNASE1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RNASE1-6184H | Recombinant Human RNASE1 Protein (Lys29-Thr156), C-His tagged | +Inquiry |
| RNASE1-12H | Active Recombinant Human RNASE1 Protein, His-tagged | +Inquiry |
| RNASE1-7682H | Recombinant Human RNASE1, His-tagged | +Inquiry |
| RNASE1-3909R | Recombinant Rhesus monkey RNASE1 Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| RNASE1-392C | Native Cattle RNASE1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNASE1-1283HCL | Recombinant Human RNASE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASE1 Products
Required fields are marked with *
My Review for All RNASE1 Products
Required fields are marked with *



