Active Recombinant Full Length Human RNASE1 Protein, C-Flag-tagged
Cat.No. : | RNASE1-02HFL |
Product Overview : | Recombinant Full Length Human RNASE1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme activity In vivo treatment Cell treatment Binding assay In vivo treatment |
Molecular Mass : | 14.5 kDa |
AA Sequence : | MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKP VNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEG SPYVPVHFDASVEDSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | RNASE1 ribonuclease A family member 1, pancreatic [ Homo sapiens (human) ] |
Official Symbol | RNASE1 |
Synonyms | RAC1; RIB1; RNS1 |
Gene ID | 6035 |
mRNA Refseq | NM_198235.3 |
Protein Refseq | NP_937878.1 |
MIM | 180440 |
UniProt ID | P07998 |
◆ Recombinant Proteins | ||
Rnase1-395M | Recombinant Mouse Rnase1 Protein, His/GST-tagged | +Inquiry |
RNASE1-1344H | Recombinant Human RNASE1 Protein, MYC/DDK-tagged | +Inquiry |
RNASE1-6184H | Recombinant Human RNASE1 Protein (Lys29-Thr156), C-His tagged | +Inquiry |
Rnase1-396R | Recombinant Rat Rnase1 Protein, His/GST-tagged | +Inquiry |
RNASE1-12H | Active Recombinant Human RNASE1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
RNASE1-392C | Native Cattle RNASE1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNASE1-1283HCL | Recombinant Human RNASE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNASE1 Products
Required fields are marked with *
My Review for All RNASE1 Products
Required fields are marked with *
0
Inquiry Basket