Recombinant Human RNASE1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RNASE1-3424H |
Product Overview : | RNASE1 MS Standard C13 and N15-labeled recombinant protein (NP_937878) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. |
Molecular Mass : | 17.6 kDa |
AA Sequence : | MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RNASE1 ribonuclease A family member 1, pancreatic [ Homo sapiens (human) ] |
Official Symbol | RNASE1 |
Synonyms | RNASE1; ribonuclease, RNase A family, 1 (pancreatic); RNS1; ribonuclease pancreatic; RIB-1; RNase 1; RNase A; HP-RNase; RNase upI-1; ribonuclease 1; ribonuclease A; RIB1; MGC12408; |
Gene ID | 6035 |
mRNA Refseq | NM_198235 |
Protein Refseq | NP_937878 |
MIM | 180440 |
UniProt ID | P07998 |
◆ Recombinant Proteins | ||
Rnase1-395M | Recombinant Mouse Rnase1 Protein, His/GST-tagged | +Inquiry |
RNASE1-12H | Active Recombinant Human RNASE1 Protein, His-tagged | +Inquiry |
RNASE1-3909R | Recombinant Rhesus monkey RNASE1 Protein, His-tagged | +Inquiry |
RNASE1-1344H | Recombinant Human RNASE1 Protein, MYC/DDK-tagged | +Inquiry |
RNASE1-6182H | Recombinant Human RNASE1 Protein (Lys29-Thr156), C-His tagged | +Inquiry |
◆ Native Proteins | ||
RNASE1-392C | Native Cattle RNASE1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNASE1-1283HCL | Recombinant Human RNASE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASE1 Products
Required fields are marked with *
My Review for All RNASE1 Products
Required fields are marked with *