Recombinant Human RNASE1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RNASE1-3424H
Product Overview : RNASE1 MS Standard C13 and N15-labeled recombinant protein (NP_937878) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified.
Molecular Mass : 17.6 kDa
AA Sequence : MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RNASE1 ribonuclease A family member 1, pancreatic [ Homo sapiens (human) ]
Official Symbol RNASE1
Synonyms RNASE1; ribonuclease, RNase A family, 1 (pancreatic); RNS1; ribonuclease pancreatic; RIB-1; RNase 1; RNase A; HP-RNase; RNase upI-1; ribonuclease 1; ribonuclease A; RIB1; MGC12408;
Gene ID 6035
mRNA Refseq NM_198235
Protein Refseq NP_937878
MIM 180440
UniProt ID P07998

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNASE1 Products

Required fields are marked with *

My Review for All RNASE1 Products

Required fields are marked with *

0
cart-icon
0
compare icon