Active Recombinant Human ACP1 Protein, his-Tagged

Cat.No. : ACP1-177H
Product Overview : Human ACP1 (NP_009030, 1 a.a. - 158 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2008]
Form : Liquid
Bio-activity : Activity tested: > 60,000 unit/mg of protein
Molecular Mass : 20.1 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Endotoxin : < 1.0 EU per 1 microgram of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : Functional Study SDS-PAGE
Storage : Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : 1 mg/mL
Storage Buffer : In 20 mM MES 6.0, 0.1 mM PMSF, 2 mM EDTA (10% glycerol)
Gene Name ACP1 acid phosphatase 1, soluble [ Homo sapiens ]
Official Symbol ACP1
Synonyms ACP1; acid phosphatase 1, soluble; low molecular weight phosphotyrosine protein phosphatase; LMW-PTP; LMW-PTPase; adipocyte acid phosphatase; red cell acid phosphatase 1; protein tyrosine phosphatase; acid phosphatase of erythrocyte; cytoplasmic phosphotyrosyl protein phosphatase; low molecular weight cytosolic acid phosphatase; HAAP; MGC3499; MGC111030;
Gene ID 52
mRNA Refseq NM_001040649
Protein Refseq NP_001035739
MIM 171500
UniProt ID P24666

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACP1 Products

Required fields are marked with *

My Review for All ACP1 Products

Required fields are marked with *

0
cart-icon