Active Recombinant Human ACP1 Protein, his-Tagged

• Cat.No.: ACP1-177H
• Product Overview: Human ACP1 (NP_009030, 1 a.a. - 158 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2008]
• Form: Liquid
• Bio-activity: Activity tested: > 60,000 unit/mg of protein
• Molecular Mass: 20.1 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
• Endotoxin: < 1.0 EU per 1 microgram of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: Functional Study SDS-PAGE
• Storage: Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: 1 mg/mL
• Storage Buffer: In 20 mM MES 6.0, 0.1 mM PMSF, 2 mM EDTA (10% glycerol)

Gene Information

• Gene Name: ACP1 acid phosphatase 1, soluble [ Homo sapiens ]
• Official Symbol: ACP1
• Synonyms: ACP1; acid phosphatase 1, soluble; low molecular weight phosphotyrosine protein phosphatase; LMW-PTP; LMW-PTPase; adipocyte acid phosphatase; red cell acid phosphatase 1; protein tyrosine phosphatase; acid phosphatase of erythrocyte; cytoplasmic phosphotyrosyl protein phosphatase; low molecular weight cytosolic acid phosphatase; HAAP; MGC3499; MGC111030
• Gene ID: 52
• mRNA Refseq: NM_001040649
• Protein Refseq: NP_001035739
• MIM: 171500
• UniProt ID: P24666