Active Recombinant human CA5A Full Length protein, His-tagged
| Cat.No. : | CA5A-719H |
| Product Overview : | Recombinant Human CA5A protein(Ala40-Ser305), fused with C-terminal His tag, was expressed in E. coli. |
| Availability | October 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Ala40-Ser305 |
| Tag : | C-His |
| Form : | Liquid in sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose. |
| Bio-activity : | Measured by its esterase activity. The specific activity is >500 pmoles/min/μg. |
| Molecular Mass : | The protein has a calculated MW of 31 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.9 mg/ml. |
| Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRSAHHHHHHHHHH |
| Gene Name | CA5A carbonic anhydrase VA, mitochondrial [ Homo sapiens ] |
| Official Symbol | CA5A |
| Synonyms | CA5A; carbonic anhydrase VA, mitochondrial; CA5; carbonic anhydrase 5A, mitochondrial; CAV; CAVA; CA-VA; carbonic dehydratase; carbonate dehydratase VA; carbonic anhydrase V, mitochondrial; |
| Gene ID | 763 |
| mRNA Refseq | NM_001739 |
| Protein Refseq | NP_001730 |
| MIM | 114761 |
| UniProt ID | P35218 |
| ◆ Recombinant Proteins | ||
| CA5A-1142H | Recombinant Human CA5A, His tagged | +Inquiry |
| CA5A-5924H | Recombinant Human CA5A protein, His-tagged | +Inquiry |
| CA5A-2562H | Recombinant Human CA5A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CA5A-2269H | Recombinant Human CA5A Protein, MYC/DDK-tagged | +Inquiry |
| Car5a-7850M | Recombinant Mouse Car5a protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA5A Products
Required fields are marked with *
My Review for All CA5A Products
Required fields are marked with *
