Active Recombinant Human CD38 Protein, Fc-tagged, Alexa Fluor 555 conjugated
Cat.No. : | CD38-574HAF555 |
Product Overview : | The Alexa Fluor 555 conjugated recombinant human CD38-Fc is expressed as a 482-amino acid protein consisting of Arg47 - Ile300 region of CD38 (UniProt accession #P28907) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
Availability | October 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 47-300 a.a. |
Bio-activity : | Immobilized CD38 binds anti-CD38 monoclonal antibodies, human IgG1, mouse IgG2a and rabbit IgG in a functional ELISA. Converts the enzymatic substrate nicotinamide guanine dinucleotide (NGD+) to cyclic GDP-ribose. |
Molecular Mass : | Calculated molecular mass (kDa): 54.9; Estimated by SDS-PAGE under reducing condition (kDa): 60-70 |
AA Sequence : | RQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSR RFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISK RNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEISTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | < 0.1 EU/ μg of purified recombinant protein determined by the LAL method |
Purity : | > 95 % by SDS-PAGE under reducing condition |
Characteristic : | Disulfide-linked homodimer Labeled with Alexa Fluor 555 via amines With an excitation and emission maximum of 555/565 nm, Alexa Fluor 555 can be efficiently excited using a 543 nm He-Ne laser line and detected under standard TRITC/Cy3 filters. |
Storage : | The product is shipped at 4 centigrade. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20 centigrade for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4 centigrade for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Supplied at 0.5 mg/ml in sterile PBS pH 7.4 (carrier & preservative free). |
Conjugation : | Alexa Fluor 555 |
Gene Name | CD38 CD38 molecule [ Homo sapiens ] |
Official Symbol | CD38 |
Synonyms | CD38; CD38 molecule; CD38 antigen (p45); ADP-ribosyl cyclase 1; ADP ribosyl cyclase 1; NAD(+) nucleosidase; cADPr hydrolase 1; cyclic ADP-ribose hydrolase 1; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase; T10; |
Gene ID | 952 |
mRNA Refseq | NM_001775 |
Protein Refseq | NP_001766 |
MIM | 107270 |
UniProt ID | P28907 |
◆ Recombinant Proteins | ||
CD38-653H | Recombinant Human CD38 protein, His-tagged | +Inquiry |
CD38-4486C | Recombinant Chicken CD38 | +Inquiry |
CD38-25H | Recombinant Human CD38 Protein, N-6His-Avi tagged, Biotinylated | +Inquiry |
CD38-3170HF | Recombinant Full Length Human CD38 Protein, GST-tagged | +Inquiry |
Cd38-1459M | Recombinant Mouse Cd38 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD38-1259RCL | Recombinant Rat CD38 cell lysate | +Inquiry |
CD38-1557HCL | Recombinant Human CD38 cell lysate | +Inquiry |
CD38-1398CCL | Recombinant Cynomolgus CD38 cell lysate | +Inquiry |
CD38-2639MCL | Recombinant Mouse CD38 cell lysate | +Inquiry |
CD38-1025RCL | Recombinant Rabbit CD38 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD38 Products
Required fields are marked with *
My Review for All CD38 Products
Required fields are marked with *