Active Recombinant Human FGF1 Protein (Carry Free-Lyophilized, 140 amino acid)

Cat.No. : FGF1-12H
Product Overview : Recombinant Human FGF1 Protein (Carry Free-Lyophilized) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 140 amino acid
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described.
Form : Lyophilized
Bio-activity : ED50 < 0.1 ng/mL as determined by its ability to the dose dependent proliferation of mouse Balb/c 3T3 cells.
Molecular Mass : 15.8 kDa
AA Sequence : FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Endotoxin : < 1.0 EU/μg of protein as determined by the LAL assay
Purity : > 98% by SDS-PAGE
Storage : It is stable for up to 6 months from date of receipt when stored at -20 centigrade. Multiple freeze/thaw cycles should be avoided as it can result in significant loss of activity.
Storage Buffer : Sterile filtered through a 0.2 micron filter. Lyophilized with no additives.
Reconstitution : Centrifuge the vial before opening. Reconstitute in sterile water to aconcentration of 0.1 -1.0 mg/mL. Do not vortex. For extended storage, it isrecommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20 to -80 centigrade.
Shipping : This product is shipped at 4 centigrade with cold pack.
Gene Name FGF1 fibroblast growth factor 1 [ Homo sapiens (human) ]
Official Symbol FGF1
Synonyms FGF1; fibroblast growth factor 1; AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha; fibroblast growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, alpha; endothelial cell growth factor, beta; fibroblast growth factor 1 (acidic); heparin-binding growth factor 1
Gene ID 2246
mRNA Refseq NM_000800
Protein Refseq NP_000791
MIM 131220
UniProt ID P05230

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF1 Products

Required fields are marked with *

My Review for All FGF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon