Active Recombinant Human FGF18 Protein

• Cat.No.: FGF18-031H
• Product Overview: Recombinant Human FGF18 Protein(O76093)(27-207 aa) was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 27-207 aa
• Form: Lyophilized from a 0.2µm filtered concentrated solution in 20mMPB pH7.2, with NaCL and Trehalose as protectant.
• Bio-activity: Fully biologically active when compared to standard. Determined by a cell proliferation assay using Balb/c 3T3 cells. The expected ED50 is ≤ 10ng/ml in the presence of 1µg/ml heparin, corresponding to a specific activity of ≥ 1 x 10^5 units/mg.
• Molecular Mass: Approximately 21.0kDa, a single non-glycosylated polypeptide chain containing 181 amino acids.
• AASequence: AEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA
• Endotoxin: <0.01EU/μg rHuFGF-18 protein as determined by LAL method.
• Purity: >96% by SDS-PAGE or HPLC.
• Storage: Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: FGF18 fibroblast growth factor 18 [ Homo sapiens ]
• Official Symbol: FGF18
• Synonyms: FGF18; fibroblast growth factor 18; FGF 18; ZFGF5; FGF-18
• Gene ID: 8817
• mRNA Refseq: NM_003862
• Protein Refseq: NP_003853
• MIM: 603726
• UniProt ID: O76093