Active Recombinant Human FGF7 Protein

Cat.No. : FGF7-229F
Product Overview : Recombinant Human FGF7 Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Description : Keratinocyte Growth Factor (KGF), also known as FGF-7 and HBGF-7, is a mitogen factor belonging to the heparin-binding growth factor family. It is expressed mainly by epithelial cells. KGF binds to fibroblast growth factor receptor 2b (FGFR2b) to form a dimeric complex and initiate downstream signals. KGF plays an important role in embryonic development, cell proliferation and differentiation. It has also been reported to function in kidney and lung development, angiogenesis, wound healing and tumor invasion.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 1 ng/mL, measured in a proliferation assay using 4MBr5 cells.
Molecular Mass : 16-18 kDa, observed by reducing SDS-PAGE.
AA Sequence : CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant human Keratinocyte Growth Factor(rhKGF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Keratinocyte Growth Factor should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name FGF7 fibroblast growth factor 7 [ Homo sapiens ]
Official Symbol FGF7
Synonyms FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7;
Gene ID 2252
mRNA Refseq NM_002009
Protein Refseq NP_002000
MIM 148180
UniProt ID P21781

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF7 Products

Required fields are marked with *

My Review for All FGF7 Products

Required fields are marked with *

0
cart-icon