Active Recombinant Human GDF15 Protein

Cat.No. : GDF15-4821H
Product Overview : Human GDF15 (Q99988) partial recombinant protein expressed in CHO cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : Non
Description : Bone morphogenetic proteins (e.g., BMP5; MIM 112265) are members of the transforming growth factor-beta (see TGFB1; MIM 190180) superfamily and regulate tissue differentiation and maintenance. They are synthesized as precursor molecules that are processed at a dibasic cleavage site to release C-terminal domains containing a characteristic motif of 7 conserved cysteines in the mature protein.[supplied by OMIM
Form : Lyophilized
Bio-activity : Determined by a cell inhibition assay using DU-145 cells. The expected ED50 for this effect is 1.0-2.0 μg/mL.
AA Sequence : ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Endotoxin : <0.1 ng/μg (<1 EU/μg)
Purity : 98%
Applications : Functional Study
SDS-PAGE
Usage : SDS-PAGE
Activity assay
The optimal working dilution should be determined by the end user.
Storage : Store at -20 centigrade.Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20 centigrade to -80 centigrade.
Storage Buffer : Lyophilized from 10mM Sodium Citrate, pH 3.0.
Gene Name GDF15 growth differentiation factor 15 [ Homo sapiens ]
Official Symbol GDF15
Synonyms GDF15; growth differentiation factor 15; growth/differentiation factor 15; MIC 1; MIC1; NAG 1; PDF; PLAB; prostate differentiation factor; PTGFB; NRG-1; PTGF-beta; placental TGF-beta; NSAID-activated gene 1 protein; NSAID-regulated gene 1 protein; macrophage inhibitory cytokine 1; placental bone morphogenetic protein; NSAID (nonsteroidal anti-inflammatory drug)-activated protein 1; MIC-1; NAG-1; GDF-15;
Gene ID 9518
mRNA Refseq NM_004864
Protein Refseq NP_004855
MIM 605312
UniProt ID Q99988

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDF15 Products

Required fields are marked with *

My Review for All GDF15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon