Active Recombinant Human GDF15 Protein

• Cat.No.: GDF15-4821H
• Product Overview: Human GDF15 (Q99988) partial recombinant protein expressed in CHO cell.

Specification

• Species: Human
• Source: CHO
• Tag: Non
• Description: Bone morphogenetic proteins (e.g., BMP5; MIM 112265) are members of the transforming growth factor-beta (see TGFB1; MIM 190180) superfamily and regulate tissue differentiation and maintenance. They are synthesized as precursor molecules that are processed at a dibasic cleavage site to release C-terminal domains containing a characteristic motif of 7 conserved cysteines in the mature protein.[supplied by OMIM
• Form: Lyophilized
• Bio-activity: Determined by a cell inhibition assay using DU-145 cells. The expected ED50 for this effect is 1.0-2.0 μg/mL.
• AA Sequence: ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
• Endotoxin: <0.1 ng/μg (<1 EU/μg)
• Purity: 98%
• Applications: Functional Study
  SDS-PAGE
• Usage: SDS-PAGE
  Activity assay
  The optimal working dilution should be determined by the end user.
• Storage: Store at -20 centigrade.Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20 centigrade to -80 centigrade.
• Storage Buffer: Lyophilized from 10mM Sodium Citrate, pH 3.0.

Gene Information

• Gene Name: GDF15 growth differentiation factor 15 [ Homo sapiens ]
• Official Symbol: GDF15
• Synonyms: GDF15; growth differentiation factor 15; growth/differentiation factor 15; MIC 1; MIC1; NAG 1; PDF; PLAB; prostate differentiation factor; PTGFB; NRG-1; PTGF-beta; placental TGF-beta; NSAID-activated gene 1 protein; NSAID-regulated gene 1 protein; macrophage inhibitory cytokine 1; placental bone morphogenetic protein; NSAID (nonsteroidal anti-inflammatory drug)-activated protein 1; MIC-1; NAG-1; GDF-15
• Gene ID: 9518
• mRNA Refseq: NM_004864
• Protein Refseq: NP_004855
• MIM: 605312
• UniProt ID: Q99988