Active Recombinant Human IL12A/IL12B protein
| Cat.No. : | IL12A-27H |
| Product Overview : | The hIL-12 consists of two subunits linked via a disulphide bond: P35 (Accession# NP_000873.2: Arg 57- Ser 253) and P40 (Accession# NP_002178.2: Ile 23-Ser 328) was expressed in insect cells as secreted protein (p35, p40). |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | Non |
| Protein Length : | 57-253;23-328 a.a. |
| Form : | The protein was 0.22μm filtered in 10mM NaH2PO4, 150mM NaCl, pH 7.2. |
| Bio-activity : | ED50 = 0.05 - 0.25 ng/ml, corresponding to a specific activity of 0.4 - 2.0 x 10^7 units/mg, as determined by the production of IFNγ by activated human PBMC in response to IL-12. |
| Molecular Mass : | The total predicted molecular weight is 57 kDa. The non-reduced protein migrates at approximately 55 kDa and the DTT-reduced protein produces two bands migrating at approximately 26 kDa and 40 KDa by SDS-PAGE. |
| AA Sequence : | RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS p40 Subunit IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWT |
| Endotoxin : | < 1 EU/µg determined by LAL method |
| Purity : | >95 % as determined by SDS-PAGE analysis |
| Applications : | ELISA, WB, Antibody Production, Protein array, Bioassay |
| Storage : | Unopened vial can be stored at -20°C for six months or at -70°C for one year. For maximum results, quick spin vial prior to opening. Stock solutions should be prepared at no less than 10µg/mL in buffer containing carrier protein such as 1% BSA or HSA or 1 |
| Gene Name | IL12A interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35) [ Homo sapiens ] |
| Official Symbol | IL12A |
| Synonyms | IL12A; interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35); NKSF1; interleukin-12 subunit alpha; CLMF; cytotoxic lymphocyte maturation factor 1; p35; IL 12; subunit p35; IL 12A; IL35 subunit; interleukin 12; interleukin 12 alpha chain; natural killer cell stimulatory factor 1; 35 kD subunit; NF cell stimulatory factor chain 1; NFSK; CLMF p35; IL-12 subunit p35; IL-12, subunit p35; interleukin 12, p35; interleukin-12 alpha chain; NK cell stimulatory factor chain 1; cytotoxic lymphocyte maturation factor 1, p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; natural killer cell stimulatory factor 1, 35 kD subunit; P35; IL-12A; |
| Gene ID | 3592 |
| mRNA Refseq | NM_000882 |
| Protein Refseq | NP_000873 |
| MIM | 161560 |
| UniProt ID | P29459 |
| Chromosome Location | 3p12-q13.2 |
| Pathway | African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; |
| Function | contributes_to cytokine activity; contributes_to cytokine activity; contributes_to growth factor activity; contributes_to growth factor activity; interleukin-12 beta subunit binding; interleukin-12 receptor binding; interleukin-27 binding; protein binding |
| ◆ Recombinant Proteins | ||
| IL12A-5833H | Recombinant Human IL12A and EBI3 Protein (Arg23-Ser219, Arg21-Lys229), C-Fc tagged | +Inquiry |
| Il12a-227M | Recombinant Mouse Interleukin 12a, P40 | +Inquiry |
| IL12A-132H | Recombinant Human interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35), His-tagged | +Inquiry |
| IL12A-29635TH | Recombinant Human IL12A, His-tagged | +Inquiry |
| IL12A-190C | Recombinant Cynomolgus IL12A | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL12A-2435HCL | Recombinant Human IL12A cell lysate | +Inquiry |
| IL12A-001CCL | Recombinant Cynomolgus IL12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL12A Products
Required fields are marked with *
My Review for All IL12A Products
Required fields are marked with *




