Active Recombinant Human IL12A/IL12B protein
Cat.No. : | IL12A-27H |
Product Overview : | The hIL-12 consists of two subunits linked via a disulphide bond: P35 (Accession# NP_000873.2: Arg 57- Ser 253) and P40 (Accession# NP_002178.2: Ile 23-Ser 328) was expressed in insect cells as secreted protein (p35, p40). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | Non |
Protein Length : | 57-253;23-328 a.a. |
Form : | The protein was 0.22μm filtered in 10mM NaH2PO4, 150mM NaCl, pH 7.2. |
Bio-activity : | ED50 = 0.05 - 0.25 ng/ml, corresponding to a specific activity of 0.4 - 2.0 x 10^7 units/mg, as determined by the production of IFNγ by activated human PBMC in response to IL-12. |
Molecular Mass : | The total predicted molecular weight is 57 kDa. The non-reduced protein migrates at approximately 55 kDa and the DTT-reduced protein produces two bands migrating at approximately 26 kDa and 40 KDa by SDS-PAGE. |
AA Sequence : | RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS p40 Subunit IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWT |
Endotoxin : | < 1 EU/µg determined by LAL method |
Purity : | >95 % as determined by SDS-PAGE analysis |
Applications : | ELISA, WB, Antibody Production, Protein array, Bioassay |
Storage : | Unopened vial can be stored at -20°C for six months or at -70°C for one year. For maximum results, quick spin vial prior to opening. Stock solutions should be prepared at no less than 10µg/mL in buffer containing carrier protein such as 1% BSA or HSA or 1 |
Gene Name | IL12A interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35) [ Homo sapiens ] |
Official Symbol | IL12A |
Synonyms | IL12A; interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35); NKSF1; interleukin-12 subunit alpha; CLMF; cytotoxic lymphocyte maturation factor 1; p35; IL 12; subunit p35; IL 12A; IL35 subunit; interleukin 12; interleukin 12 alpha chain; natural killer cell stimulatory factor 1; 35 kD subunit; NF cell stimulatory factor chain 1; NFSK; CLMF p35; IL-12 subunit p35; IL-12, subunit p35; interleukin 12, p35; interleukin-12 alpha chain; NK cell stimulatory factor chain 1; cytotoxic lymphocyte maturation factor 1, p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; natural killer cell stimulatory factor 1, 35 kD subunit; P35; IL-12A; |
Gene ID | 3592 |
mRNA Refseq | NM_000882 |
Protein Refseq | NP_000873 |
MIM | 161560 |
UniProt ID | P29459 |
Chromosome Location | 3p12-q13.2 |
Pathway | African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; |
Function | contributes_to cytokine activity; contributes_to cytokine activity; contributes_to growth factor activity; contributes_to growth factor activity; interleukin-12 beta subunit binding; interleukin-12 receptor binding; interleukin-27 binding; protein binding |
◆ Recombinant Proteins | ||
IL12A-850H | Recombinant Human IL12A protein, His & S-tagged | +Inquiry |
Il12a-6737M | Recombinant Mouse Il12a Protein (Met23-Ser335, Arg23-Ala215) | +Inquiry |
IL12A-587H | Recombinant Human IL12A protein, His-tagged | +Inquiry |
IL35-12H | Recombinant Human IL12A/IL27B protein, Fc-tagged | +Inquiry |
Il12a-853R | Recombinant Rat Il12a protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12A-001CCL | Recombinant Cynomolgus IL12A cell lysate | +Inquiry |
IL12A-2435HCL | Recombinant Human IL12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL12A Products
Required fields are marked with *
My Review for All IL12A Products
Required fields are marked with *
0
Inquiry Basket