| Species : |
Human |
| Source : |
Nicotiana Benthamiana |
| Tag : |
His |
| Protein Length : |
20-152 a.a. |
| Description : |
IL-3 is a potent growth factor involved in a variety of cell activities such as cell growth, differentiation and apoptosis.It takes part of several biological responses such as proliferation, and differentiation of a broad range of hematopoietic progenitor cells into erythrocytes, granulocytes, monocytes, megakaryocytic and mast cells. IL-3 also induces the production of several enzymes involved in cellular metabolism, differentiation, and DNA/RNA metabolism.IL-3 is produced by activated T-lymphocytes, keratinocytes, NK-cells, mast cells, endothelial cells and monocytes. The biological activity of IL-3 is mediated through specific cell surface receptor that is composed of alpha and beta subunits. Alpha subunit is responsible for the binding and beta subunit transmits signals across the plasma membrane; il-3 is known to activate three signalling pathways: JAK/STAT, RAS/RAF/MAP kinase, and the PI-3kinase/PKB pathways.IL-3 is also implicated in the pathogenesis of several diseases such as asthma, athero sclerosis and multiple sclerosis. Recombinant protein has been widely used in clinical practice, in the treatment of leukemia and as therapy for patients with bone marrow deficiency function. |
| Form : |
Recombinant human IL-3 is lyophilized from PBS 1X buffer pH 7.4. |
| Bio-activity : |
The activity is determined by the dose-dependent stimulation of TF-1 cells. ED50 of Agrenvec′s rHuman IL-3 is typically less than 1 ng/ml. |
| Molecular Mass : |
rhuman Interleukin-3 is a glycosylated polypeptide chain containing 133 amino acids (20 – 152 of P08700 IL3_HUMAN) and a His-tag at the N-terminal end. It has a predicted molecular mass of 16.2 KDa, however as result of glycosylation, the recombinant p |
| AA Sequence : |
HHHHHHHHAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKS LQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Endotoxin : |
< 0.04="" eu="" ug="" protein="" (lal=""> |
| Purity : |
>97% by SDS-PAGE gel |
| Applications : |
Cell culture, Western Blot |
| Storage : |
This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended. |
| Reconstitution : |
Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Optimal concentration should be determined for specific application and cell lines. Optimal reconstitution please follow batch Quality Control sheet instructions. |