Recombinant Human IL3 protein
Cat.No. : | IL3-08H |
Product Overview : | Recombinant Human IL3 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 133 |
Description : | Interleukin-3 (IL-3) is an interleukin, a type of biological signal (cytokine) which is encoded by the IL-3 gene located on chromosome 5 and produced primarily by activated T cells beside human thymic epithelial cells, activated murine mast cells, murine keratinocytes and neurons/astrocytes. The protein acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. The human IL-3 reported to be a monomer, as it is known, contains 133 amino acids residues which is a single non-glycosylated polypeptide. Specifically, human and murine IL-3 share low homology and it does not show activity on murine cells. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁷ IU/mg. |
Molecular Mass : | Approximately 15.0 kDa, a single non-glycosylated polypeptide chain containing 133 amino acids. |
AA Sequence : | APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
Endotoxin : | Less than 1 EU/µg of rHuIL-3 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL3 |
Official Symbol | IL3 |
Synonyms | IL3; interleukin 3 (colony-stimulating factor, multiple); interleukin-3; hematopoietic growth factor; IL 3; mast cell growth factor; MCGF; MGC79398; MGC79399; MULTI CSF; multilineage colony stimulating factor; P cell stimulating factor; mast-cell growth factor; P-cell stimulating factor; P-cell-stimulating factor; multilineage-colony-stimulating factor; multipotential colony-stimulating factor; IL-3; MULTI-CSF; |
Gene ID | 3562 |
mRNA Refseq | NM_000588 |
Protein Refseq | NP_000579 |
MIM | 147740 |
UniProt ID | P08700 |
◆ Recombinant Proteins | ||
Il3-1037R | Recombinant Rat Il3 Protein, His-tagged | +Inquiry |
IL3-08H | Recombinant Human IL3 protein | +Inquiry |
IL3-4316H | Active Recombinant Human IL3 protein | +Inquiry |
Il3-592M | Active Recombinant Mouse Interleukin 3 | +Inquiry |
IL3-2481H | Recombinant Human IL3 Protein (Ala20-Phe152), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL3 Products
Required fields are marked with *
My Review for All IL3 Products
Required fields are marked with *
0
Inquiry Basket