Active Recombinant Human KDM1A protein
Cat.No. : | KDM1A-48H |
Product Overview : | Recombinant Human KDM1A(158–end) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants. |
Form : | 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 1 mM DTT, 1 mM EDTA, 0.05% Tween-20, and 20% glycerol. |
Bio-activity : | ≥20.6 pmol/min/µg |
Molecular Mass : | 77.9 kDa |
AA Sequence : | GPLGSPEFAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDN PKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQ SFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKE KDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNK MVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYL SSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYT ASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVF WDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPK ETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGL REAGRIADQFLGAMYTLPRQATPGVPAQQSPSM |
Purity : | ≥90% |
Applications : | Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling. |
Storage : | >6 months at –80 centigrade. |
Concentration : | 0.3 mg/ml |
Gene Name | KDM1A lysine (K)-specific demethylase 1A [ Homo sapiens ] |
Official Symbol | KDM1A |
Synonyms | KDM1A; lysine (K)-specific demethylase 1A; amine oxidase (flavin containing) domain 2 , AOF2, KDM1, lysine (K) specific demethylase 1; lysine-specific histone demethylase 1A; BHC110; KIAA0601; LSD1; lysine (K)-specific demethylase 1; BRAF35-HDAC complex protein BHC110; lysine-specific histone demethylase 1; amine oxidase (flavin containing) domain 2; FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit; flavin-containing amine oxidase domain-containing protein 2; AOF2; KDM1; |
Gene ID | 23028 |
mRNA Refseq | NM_015013 |
Protein Refseq | NP_055828 |
MIM | 609132 |
UniProt ID | O60341 |
Chromosome Location | 1p36.12 |
Pathway | Coregulation of Androgen receptor activity, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; |
Function | MRF binding; androgen receptor binding; chromatin binding; demethylase activity; enzyme binding; flavin adenine dinucleotide binding; histone demethylase activity; histone demethylase activity (H3-K4 specific); histone demethylase activity (H3-K9 specific); histone demethylase activity (H3-dimethyl-K4 specific); ligand-dependent nuclear receptor transcription coactivator activity; oxidoreductase activity; p53 binding; protein binding; transcription factor binding; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
Kdm1a-3680M | Recombinant Mouse Kdm1a Protein, Myc/DDK-tagged | +Inquiry |
KDM1A-1240H | Recombinant Human KDM1A Protein, His (Fc)-Avi-tagged | +Inquiry |
KDM1A-4775M | Recombinant Mouse KDM1A Protein, His (Fc)-Avi-tagged | +Inquiry |
KDM1A-48H | Active Recombinant Human KDM1A protein | +Inquiry |
KDM1A-15H | Active Recombinant Human KDM1A protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDM1A-001HCL | Recombinant Human KDM1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KDM1A Products
Required fields are marked with *
My Review for All KDM1A Products
Required fields are marked with *