Active Recombinant Human KDM1A protein

Cat.No. : KDM1A-48H
Product Overview : Recombinant Human KDM1A(158–end) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants.
Form : 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 1 mM DTT, 1 mM EDTA, 0.05% Tween-20, and 20% glycerol.
Bio-activity : ≥20.6 pmol/min/µg
Molecular Mass : 77.9 kDa
AA Sequence : GPLGSPEFAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDN PKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQ SFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKE KDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNK MVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYL SSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYT ASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVF WDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPK ETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGL REAGRIADQFLGAMYTLPRQATPGVPAQQSPSM
Purity : ≥90%
Applications : Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.
Storage : >6 months at –80 centigrade.
Concentration : 0.3 mg/ml
Gene Name KDM1A lysine (K)-specific demethylase 1A [ Homo sapiens ]
Official Symbol KDM1A
Synonyms KDM1A; lysine (K)-specific demethylase 1A; amine oxidase (flavin containing) domain 2 , AOF2, KDM1, lysine (K) specific demethylase 1; lysine-specific histone demethylase 1A; BHC110; KIAA0601; LSD1; lysine (K)-specific demethylase 1; BRAF35-HDAC complex protein BHC110; lysine-specific histone demethylase 1; amine oxidase (flavin containing) domain 2; FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit; flavin-containing amine oxidase domain-containing protein 2; AOF2; KDM1;
Gene ID 23028
mRNA Refseq NM_015013
Protein Refseq NP_055828
MIM 609132
UniProt ID O60341
Chromosome Location 1p36.12
Pathway Coregulation of Androgen receptor activity, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem;
Function MRF binding; androgen receptor binding; chromatin binding; demethylase activity; enzyme binding; flavin adenine dinucleotide binding; histone demethylase activity; histone demethylase activity (H3-K4 specific); histone demethylase activity (H3-K9 specific); histone demethylase activity (H3-dimethyl-K4 specific); ligand-dependent nuclear receptor transcription coactivator activity; oxidoreductase activity; p53 binding; protein binding; transcription factor binding; transcription regulatory region DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KDM1A Products

Required fields are marked with *

My Review for All KDM1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon