Active Recombinant Human MMP2 protein, No Activation Required
Cat.No. : | MMP2-12H |
Product Overview : | Matrix Metalloproteinase-2 (MMP-2, Gelatinase A, Type IV collagenase) catalytic domain without fibronectin domains cloned from human cDNA, expressed in E. coli. The enzyme consists of the catalytic domain of human MMP-2 fibronectin deficient (residues 115-214 and 393-447 where the residue numbers are based on the unprocessed precursor, UniProtKB accession P08253). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 115-214, 393-447 |
Description : | Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. |
Bio-activity : | > 40 U/μg. Activity described as U=100 pmol/min at 25 centigrade using a colorimetric assay with thiopeptide Ac-Pro-Leu-Gly-[2-mercapto-4-methyl-pentanoyl]-Leu-Gly-OC2H5 as substrate. |
Molecular Mass : | 17.5 kDa |
AA Sequence : | M-RKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGA |
Purity : | > 95% by SDS-PAGE. The protein is observed, in denaturing conditions, as a single band migrating at a molecular weight between 14.4 and 18.4 kDa. |
Applications : | Enzyme kinetic studies, cleavage of target substrates and screening of inhibitors. |
Storage : | At -80 centigrade. After initial defrost, aliquot the product into individual tubes and refreeze at -80 centigrade. Avoid repeated freeze/thaw cycles. |
Concentration : | 0.15 mg/mL |
Storage Buffer : | Tris 20 mM pH 7.2, CaCl2 10 mM, ZnCl2 0.1 mM, NaCl 0.3 M, acetohydroxamic acid (AHA) 0.5 M, glycerol 10%, Brij-35 0.05%. The concentration is calculated by the analysis of the absorbance at 280 nm (ε280= 32430 M-1cm-1 calculated). |
Shipping : | On Dry Ice |
Gene Name | MMP2 matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) [ Homo sapiens (human) ] |
Official Symbol | MMP2 |
Synonyms | MMP2; matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase); CLG4, CLG4A, matrix metalloproteinase 2 (gelatinase A, 72kD gelatinase, 72kD type IV collagenase) , matrix metalloproteinase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase); 72 kDa type IV collagenase; TBE 1; MMP-2; gelatinase A; 72 kDa gelatinase; collagenase type IV-A; neutrophil gelatinase; matrix metalloproteinase-2; matrix metalloproteinase-II; CLG4; MONA; CLG4A; TBE-1; MMP-II; |
Gene ID | 4313 |
mRNA Refseq | NM_001127891 |
Protein Refseq | NP_001121363 |
MIM | 120360 |
UniProt ID | P08253 |
◆ Recombinant Proteins | ||
MMP2-3371R | Recombinant Rat MMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Mmp2-10593M | Recombinant Mouse Mmp2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMP2-8392HA | Recombinant Human MMP2 protein, GST-tagged, APC labeled | +Inquiry |
MMP2-3715R | Recombinant Rat MMP2 Protein | +Inquiry |
MMP2-169H | Recombinant Human MMP2 | +Inquiry |
◆ Native Proteins | ||
MMP2-46H | Native Human MMP-2 | +Inquiry |
MMP2-29475TH | Native Human MMP2 | +Inquiry |
MMP2-8455M | Native Mouse MMP2 | +Inquiry |
MMP2-47H | Native Human MMP-2/TIMP-2 Complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP2-2380HCL | Recombinant Human MMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP2 Products
Required fields are marked with *
My Review for All MMP2 Products
Required fields are marked with *