Active Recombinant Human MSLN, His-tagged, Biotinylated
Cat.No. : | MSLN-642H |
Product Overview : | The recombinant human MSLN is expressed as a 317-amino acid protein consisting of Glu296 - Ser592 region of MSLN (UniProt accession #Q13421, isoform 2) and a C-terminal His-tag. It contains 4 potential N-linked glycosylation sites. |
Availability | June 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | His |
Protein Length : | 296-592 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds to CA125/MUC16 and anti-MSLN monoclonal antibody, human IgG1 with high affinity KD< 5 nM as measured by ELISA. |
Molecular Mass : | Calculated molecular mass (kDa): 35.9; Estimated by SDS-PAGE under reducing condition (kDa): 48-50 |
AA Sequence : | EVEKTACPSGKKAREIDESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDELYPQGYPESVIQ HLGYLFLKMSPEDIRKWNVTSLETLKALLEVNKGHEMSPQVATLIDRFVKGRGQLDKDTLDTLTAFYPGYLCSL SPEELSSVPPSSIWAVRPQDLDTCDPRQLDVLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSM DLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLS TTENLYFQGSTGHHHHHHHH |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >90% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | MSLN mesothelin [ Homo sapiens ] |
Official Symbol | MSLN |
Synonyms | MSLN; mesothelin; CAK1; MPF; CAK1 antigen; megakaryocyte potentiating factor; soluble MPF mesothelin related protein; pre-pro-megakaryocyte-potentiating factor; SMRP; |
Gene ID | 10232 |
mRNA Refseq | NM_001177355 |
Protein Refseq | NP_001170826 |
MIM | 601051 |
UniProt ID | Q13421 |
Chromosome Location | 16p13.3 |
◆ Recombinant Proteins | ||
MSLN-528HAF647 | Active Recombinant Human MSLN Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
MSLN-528HA | Recombinant Human MSLN protein, Fc-tagged, APC labeled | +Inquiry |
MSLN-2967H | Recombinant Human MSLN, Fc Tagged, Biotinylated | +Inquiry |
MSLN-340HA | Recombinant Human MSLN protein, Fc-tagged, APC labeled | +Inquiry |
MSLN-491H | Recombinant Human MSLN protein(Glu296-Gly580) | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSLN-1343HCL | Recombinant Human MSLN cell lysate | +Inquiry |
MSLN-1316HCL | Recombinant Human MSLN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSLN Products
Required fields are marked with *
My Review for All MSLN Products
Required fields are marked with *