Active Recombinant Human NGAL Protein
Cat.No. : | LCN2-1026H |
Product Overview : | Recombinant Human neutrophil gelatinase-associated lipocalin (NGAL) protein with a C-terminal histidine tag. Predicted molecular weight: 22 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Neutrophil gelatinase-associated lipocalin (NGAL) is a small glycoprotein expressed in the bone marrow, epithelial tissues associated with antimicrobial defense, and in the distal tubules and collecting duct of the kidney. Elevated levels of blood and urine NGAL are associated with acute or chronic renal failure |
Form : | Lyophilized from 0.2 μm filtered solution |
Bio-activity : | Anti-h NGAL 4202: + Anti-h NGAL 4203: + Anti-h NGAL 4204: + Anti-h NGAL 4205: + |
Molecular Mass : | 22 kDa |
AA Sequence : | QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNV TSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYF KITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDGSGGHHHHHHHH |
Storage : | 2–8centigrade |
Concentration : | 0.5 mg/ml when reconstituted with 200 µl of deionized water |
Storage Buffer : | Phosphate buffered saline, pH 7.4; containing 3 % sucrose, 2 % D-mannitol and 0.01 % Tween 20 as stabilizers |
Reconstitution : | Reconstitute lyophilized protein with 200 µl of deionized water |
Gene Name | LCN2 lipocalin 2 [ Homo sapiens ] |
Official Symbol | LCN2 |
Synonyms | LCN2; lipocalin 2; lipocalin 2 (oncogene 24p3); neutrophil gelatinase-associated lipocalin; 24p3; neutrophil gelatinase associated lipocalin; NGAL; oncogene 24p3; siderocalin; p25; lipocalin-2; migration-stimulating factor inhibitor; 25 kDa alpha-2-microglobulin-related subunit of MMP-9; MSFI; |
Gene ID | 3934 |
mRNA Refseq | NM_005564 |
Protein Refseq | NP_005555 |
MIM | 600181 |
UniProt ID | P80188 |
◆ Recombinant Proteins | ||
LCN2-44H | Recombinant Human Neutrophil Gelatinase Associated Lipocalin/Lipocalin-2,His-tagged | +Inquiry |
LCN2-2574H | Active Recombinant Human LCN2 protein | +Inquiry |
LCN2-6896P | Recombinant Pig LCN2 protein, His & T7-tagged | +Inquiry |
LCN2-28594TH | Recombinant Human LCN2 protein | +Inquiry |
LCN2-1026H | Active Recombinant Human NGAL Protein | +Inquiry |
◆ Native Proteins | ||
LCN2-384H | Native Human LCN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCN2-538RCL | Recombinant Rat LCN2 cell lysate | +Inquiry |
LCN2-2781MCL | Recombinant Mouse LCN2 cell lysate | +Inquiry |
LCN2-2895HCL | Recombinant Human LCN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LCN2 Products
Required fields are marked with *
My Review for All LCN2 Products
Required fields are marked with *
0
Inquiry Basket