| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Description : |
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. A neurturin mutation has been described in a family with Hirschsprung Disease. |
| Form : |
Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
| Bio-activity : |
Human Neurturin at a concentration of 100 ng/ml will support the survival of 65% of newborn rat sympathetic neurons. |
| Molecular Mass : |
11.8 kDa |
| AA Sequence : |
ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV |
| Endotoxin : |
Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : |
>95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : |
Resuspend the protein in the desired concentration in proper buffer |