Active Recombinant Human NRTN Protein
Cat.No. : | NRTN-750H |
Product Overview : | Recombinant Human NRTN was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. A neurturin mutation has been described in a family with Hirschsprung Disease. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
Bio-activity : | Human Neurturin at a concentration of 100 ng/ml will support the survival of 65% of newborn rat sympathetic neurons. |
Molecular Mass : | 11.8 kDa |
AA Sequence : | ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | NRTN neurturin [ Homo sapiens ] |
Official Symbol | NRTN |
Synonyms | NRTN; neurturin; NTN; |
Gene ID | 4902 |
mRNA Refseq | NM_004558 |
Protein Refseq | NP_004549 |
MIM | 602018 |
UniProt ID | Q99748 |
◆ Recombinant Proteins | ||
NRTN-090H | Active Recombinant Human NRTN Protein | +Inquiry |
NRTN-236H | Active Recombinant Human NRTN Protein (Ala96-Val197), C-His tagged, Animal-free, Carrier-free | +Inquiry |
NRTN-259H | Recombinant Active Human NRTN Protein, His-tagged(C-ter) | +Inquiry |
NRTN-6214M | Recombinant Mouse NRTN Protein, His (Fc)-Avi-tagged | +Inquiry |
NRTN-29535TH | Recombinant Human NRTN protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRTN Products
Required fields are marked with *
My Review for All NRTN Products
Required fields are marked with *
0
Inquiry Basket