Active Recombinant Human NRTN Protein

• Cat.No.: NRTN-750H
• Product Overview: Recombinant Human NRTN was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. A neurturin mutation has been described in a family with Hirschsprung Disease.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
• Bio-activity: Human Neurturin at a concentration of 100 ng/ml will support the survival of 65% of newborn rat sympathetic neurons.
• Molecular Mass: 11.8 kDa
• AA Sequence: ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Resuspend the protein in the desired concentration in proper buffer

Gene Information

• Gene Name: NRTN neurturin [ Homo sapiens ]
• Official Symbol: NRTN
• Synonyms: NRTN; neurturin; NTN
• Gene ID: 4902
• mRNA Refseq: NM_004558
• Protein Refseq: NP_004549
• MIM: 602018
• UniProt ID: Q99748