Active Recombinant Human NRTN Protein

Cat.No. : NRTN-750H
Product Overview : Recombinant Human NRTN was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. A neurturin mutation has been described in a family with Hirschsprung Disease.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
Bio-activity : Human Neurturin at a concentration of 100 ng/ml will support the survival of 65% of newborn rat sympathetic neurons.
Molecular Mass : 11.8 kDa
AA Sequence : ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Resuspend the protein in the desired concentration in proper buffer
Gene Name NRTN neurturin [ Homo sapiens ]
Official Symbol NRTN
Synonyms NRTN; neurturin; NTN;
Gene ID 4902
mRNA Refseq NM_004558
Protein Refseq NP_004549
MIM 602018
UniProt ID Q99748

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRTN Products

Required fields are marked with *

My Review for All NRTN Products

Required fields are marked with *

0
cart-icon