Active Recombinant Human OLIG2, GST-tagged
Cat.No. : | OLIG2-28318TH |
Product Overview : | Human OLIG2 full-length ORF ( AAH36245.1, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal. |
Availability | July 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. |
Form : | Liquid |
Bio-activity : | Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using murine NR6R/3T3 cells is less than 1.8 ng/ml, corresponding to a specific activity of > 5.6 × 10~5 IU/mg |
Molecular Mass : | 58.8 kDa |
AA Sequence : | MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPVDKLGGSGF KSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIA TLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPA AAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQV PPPHHHVSAMGAGSLPRLTSDAK |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | OLIG2 oligodendrocyte lineage transcription factor 2 [ Homo sapiens ] |
Official Symbol | OLIG2 |
Synonyms | OLIG2; oligodendrocyte lineage transcription factor 2; oligodendrocyte transcription factor 2; protein kinase C-binding protein 2; class B basic helix-loop-helix protein 1; class E basic helix-loop-helix protein 19; human protein kinase C-binding protein RACK17; basic domain, helix-loop-helix protein, class B, 1; oligodendrocyte-specific bHLH transcription factor 2; BHLHB1; OLIGO2; RACK17; PRKCBP2; bHLHe19; |
Gene ID | 10215 |
mRNA Refseq | NM_005806 |
Protein Refseq | NP_005797 |
Function | DNA binding; HMG box domain binding; protein homodimerization activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; |
◆ Recombinant Proteins | ||
OLIG2-9574Z | Recombinant Zebrafish OLIG2 | +Inquiry |
OLIG2-353HF | Active Recombinant Full Length Human OLIG2 Protein, GST-tagged | +Inquiry |
OLIG2-4438H | Recombinant Human OLIG2 protein, His-SUMO-tagged | +Inquiry |
OLIG2-38H | Recombinant Human OLIG2, GST-tagged | +Inquiry |
OLIG2-1578H | Recombinant Human OLIG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLIG2-1248HCL | Recombinant Human OLIG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OLIG2 Products
Required fields are marked with *
My Review for All OLIG2 Products
Required fields are marked with *