Active Recombinant Human THPO Protein, His-tagged

Cat.No. : THPO-01H
Product Overview : Recombinant human Thrombopoietin (22-353aa, 343aa) fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
Availability July 22, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 22-353 a.a.
Description : Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternative promoter usage and differential splicing result in multiple transcript variants differing in the 5' UTR and/or coding region. Multiple AUG codons upstream of the main open reading frame (ORF) have been identified, and these upstream AUGs inhibit translation of the main ORF at different extent.
Form : Liquid
Bio-activity : Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 range ≤10 ng/mL.
Molecular Mass : 36.8 kDa
AA Sequence : SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name THPO thrombopoietin [ Homo sapiens (human) ]
Official Symbol THPO
Synonyms THPO; thrombopoietin; ML; TPO; MGDF; MKCSF; MPLLG; THCYT1; thrombopoietin; MPL ligand; c-mpl ligand; megakaryocyte colony-stimulating factor; megakaryocyte growth and development factor; megakaryocyte stimulating factor; myeloproliferative leukemia virus oncogene ligand; prepro-thrombopoietin; thrombopoietin nirs
Gene ID 7066
mRNA Refseq NM_000460
Protein Refseq NP_000451
MIM 600044
UniProt ID P40225

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All THPO Products

Required fields are marked with *

My Review for All THPO Products

Required fields are marked with *

0
cart-icon