| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
His |
| Protein Length : |
22-353 a.a. |
| Description : |
Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternative promoter usage and differential splicing result in multiple transcript variants differing in the 5' UTR and/or coding region. Multiple AUG codons upstream of the main open reading frame (ORF) have been identified, and these upstream AUGs inhibit translation of the main ORF at different extent. |
| Form : |
Liquid |
| Bio-activity : |
Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 range ≤10 ng/mL. |
| Molecular Mass : |
36.8 kDa |
| AA Sequence : |
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG |
| Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
| Purity : |
> 90% by SDS-PAGE |
| Applications : |
SDS-PAGE, Bioactivity |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
0.25 mg/mL (determined by Absorbance at 280nm) |
| Storage Buffer : |
In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |