Active Recombinant Human TNFRSF9, Fc-tagged, Biotinylated
Cat.No. : | TNFRSF9-525H |
Product Overview : | The recombinant human 4-1BB-Fc fusion is expressed as a 390 amino acid protein consisting of Leu24 - Gln186 region of 4-1BB (UniProt accession #Q07011) and a C-terminal Fc from human IgG1, which exists as a dimer/tetramer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 24-186 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds to its ligand human 4-1BBL and anti-4-1BB monoclonal antibodies with high affinity by ELISA. Blocks 4-1BBL/4-1BB--induced signaling activity. |
Molecular Mass : | Calculated molecular mass (kDa): 42.8; Estimated by SDS-PAGE under reducing condition (kDa): 55-60 |
AA Sequence : | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGA GCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASS VTPPAPAREPGHSPQTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS VMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >90% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | TNFRSF9 tumor necrosis factor receptor superfamily, member 9 [ Homo sapiens ] |
Official Symbol | TNFRSF9 |
Synonyms | TNFRSF9; tumor necrosis factor receptor superfamily, member 9; ILA; tumor necrosis factor receptor superfamily member 9; 4 1BB; CD137; CD137 antigen; T cell antigen ILA; T-cell antigen ILA; 4-1BB ligand receptor; homolog of mouse 4-1BB; receptor protein 4-1BB; T-cell antigen 4-1BB homolog; induced by lymphocyte activation (ILA); interleukin-activated receptor, homolog of mouse Ly63; 4-1BB; CDw137; MGC2172; FLJ43501; |
Gene ID | 3604 |
mRNA Refseq | NM_001561 |
Protein Refseq | NP_001552 |
MIM | 602250 |
UniProt ID | Q07011 |
Chromosome Location | 1p36 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; |
Function | binding; receptor activity; |
◆ Recombinant Proteins | ||
TNFRSF9-01H | Active Recombinant Human TNFRSF9 Protein, His-Tagged | +Inquiry |
Tnfrsf9-784G | Recombinant Golden hamster Tnfrsf9 protein, His&Strep II-tagged | +Inquiry |
Tnfrsf9-635MAF555 | Recombinant Mouse Tnfrsf9 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
TNFRSF9-2837M | Recombinant Mouse TNFRSF9 protein, His-tagged | +Inquiry |
TNFRSF9-581HAF555 | Recombinant Human TNFRSF9 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF9-2162HCL | Recombinant Human TNFRSF9 cell lysate | +Inquiry |
TNFRSF9-928CCL | Recombinant Canine TNFRSF9 cell lysate | +Inquiry |
TNFRSF9-1792MCL | Recombinant Mouse TNFRSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF9 Products
Required fields are marked with *
My Review for All TNFRSF9 Products
Required fields are marked with *
0
Inquiry Basket