Active Recombinant Human TNFRSF9, Fc-tagged, Biotinylated
| Cat.No. : | TNFRSF9-525H |
| Product Overview : | The recombinant human 4-1BB-Fc fusion is expressed as a 390 amino acid protein consisting of Leu24 - Gln186 region of 4-1BB (UniProt accession #Q07011) and a C-terminal Fc from human IgG1, which exists as a dimer/tetramer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 24-186 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Binds to its ligand human 4-1BBL and anti-4-1BB monoclonal antibodies with high affinity by ELISA. Blocks 4-1BBL/4-1BB--induced signaling activity. |
| Molecular Mass : | Calculated molecular mass (kDa): 42.8; Estimated by SDS-PAGE under reducing condition (kDa): 55-60 |
| AA Sequence : | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGA GCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASS VTPPAPAREPGHSPQTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS VMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
| Purity : | >90% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | TNFRSF9 tumor necrosis factor receptor superfamily, member 9 [ Homo sapiens ] |
| Official Symbol | TNFRSF9 |
| Synonyms | TNFRSF9; tumor necrosis factor receptor superfamily, member 9; ILA; tumor necrosis factor receptor superfamily member 9; 4 1BB; CD137; CD137 antigen; T cell antigen ILA; T-cell antigen ILA; 4-1BB ligand receptor; homolog of mouse 4-1BB; receptor protein 4-1BB; T-cell antigen 4-1BB homolog; induced by lymphocyte activation (ILA); interleukin-activated receptor, homolog of mouse Ly63; 4-1BB; CDw137; MGC2172; FLJ43501; |
| Gene ID | 3604 |
| mRNA Refseq | NM_001561 |
| Protein Refseq | NP_001552 |
| MIM | 602250 |
| UniProt ID | Q07011 |
| Chromosome Location | 1p36 |
| Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; |
| Function | binding; receptor activity; |
| ◆ Recombinant Proteins | ||
| TNFRSF9-581HAF488 | Recombinant Human TNFRSF9 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| TNFRSF9-1025C | Recombinant Cynomolgus TNFRSF9 protein, His-tagged | +Inquiry |
| TNFRSF9-518H | Recombinant Human TNFRSF9 Protein (Leu24-Gln186), C-6×His-tagged | +Inquiry |
| TNFRSF9-550RAF555 | Active Recombinant Monkey TNFRSF9 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| TNFRSF9-346H | Recombinant Human TNFRSF9 protein, hFc-Avi-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF9-2162HCL | Recombinant Human TNFRSF9 cell lysate | +Inquiry |
| TNFRSF9-928CCL | Recombinant Canine TNFRSF9 cell lysate | +Inquiry |
| TNFRSF9-1792MCL | Recombinant Mouse TNFRSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF9 Products
Required fields are marked with *
My Review for All TNFRSF9 Products
Required fields are marked with *



