Active Recombinant Human TP53, His-tagged
Cat.No. : | TP53-3436H |
Product Overview : | Recombinant human p53 produced in human HEK293 cells is a single, glycosylated, polypeptide chain with a 6His tag at the N-terminus. It contains 412 (19+393) amino acids, and having a predicted molecular mass of approximately 45.8kD, but migrates in SDS-PAGE with an apparent molecular mass of 55kD. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Tumor proteins p53, also known as p53, cellular tumor antigen p53 (UniProt name), phosphoprotein p53, tumor suppressor p53, antigen NY-CO-13, or transformation-related protein 53 (TRP53), are encoded by homologous genes in various organisms such as TP53 (humans) and Trp53 (mice). This homolog is crucial in multicellular organisms, where it prevents cancer formation, thus, functions as a tumor suppressor. As such, p53 has been described as "the guardian of the genome" because of its role in conserving stability by preventing genome mutation. Hence TP53 is classified as a tumor suppressor gene. |
Form : | 10mM HEPES-Na (pH7.9), 150mM NaCl and 3mM EDTA |
Bio-activity : | Tumor suppressor protein p53 is involved in transcription activation, DNA repair, cell cycle arrest and apoptosis. Recombinant human p53 protein is ideal for the studies of transcriptional activation, protein-protein interactions and other related function assays. |
AA Sequence : | MHHHHHHGRRASVEDVVCCSEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFT EDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPA LNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLR VEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCA CPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALE LKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD |
Purity : | ≥90%, as determined by SDS-PAGE |
Usage : | FOR RESEARCH ONLY |
Storage : | The protein sample can be stored under sterile conditions at 2- 8 centigrade for one month or at -70 centigrade for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles. |
Gene Name | TP53 tumor protein p53 [ Homo sapiens ] |
Official Symbol | TP53 |
Synonyms | P53; BCC7; LFS1; TRP53; cellular tumor antigen p53; antigen NY-CO-13; mutant tumor protein 53; p53 tumor suppressor; phosphoprotein p53; transformation-related protein 53; tumor protein 53 |
Gene ID | 7157 |
mRNA Refseq | NM_000546 |
Protein Refseq | NP_000537 |
MIM | 191170 |
UniProt ID | P04637 |
Chromosome Location | 17p13.1 |
Pathway | AMPK signaling, organism-specific biosystem; Activation of BH3-only proteins, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem |
Function | ATP binding; DNA binding; MDM2/MDM4 family protein binding |
◆ Recombinant Proteins | ||
TP53-3412H | Active Recombinant Human TP53, His-tagged | +Inquiry |
TP53-2547H | Recombinant Human TP53 protein(301-390 aa), C-His-tagged | +Inquiry |
TP53-4922H | Recombinant Human TP53 protein(1-393aa(R273H)), His-tagged | +Inquiry |
TP53-6493H | Recombinant Human TP53 Protein (Met1-Asp393), N-Strep tagged | +Inquiry |
TP53-1077H | Active Recombinant Human Tumor Protein P53, GST-tagged | +Inquiry |
◆ Native Proteins | ||
TP53-01HFL | Active Recombinant Full Length Human TP53 Protein, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TP53-860HCL | Recombinant Human TP53 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TP53 Products
Required fields are marked with *
My Review for All TP53 Products
Required fields are marked with *
0
Inquiry Basket