Active Recombinant Human VEGF-121 Protein

Cat.No. : VEGFA-260H
Product Overview : Recombinant Human VEGF-121 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Vascular endothelial growth factor-A (VEGF-A) is produced by a wide variety of cell types, including tumor and vascular cells. VEGF-A is a mediator of vascular growth, vascular permeability, and plays a role in stimulating vasodilation via nitric oxide-dependent pathways. VEGF-A has several alternatively spliced isoforms, with one being VEGF-121. The VEGF-121 isoform is a secreted protein that acts on receptors VEGFR-1 and VEGFR-2 to modulate endothelial cell function.
Bio-activity : HUVEC proliferation, ≤5 ng/mL; ≥2.0 x 10^5 units/mg
Molecular Mass : Dimer, 14.1/28.3 kDa (121/242 aa)
AA Sequence : MPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name VEGFA vascular endothelial growth factor A [ Homo sapiens (human) ]
Official Symbol VEGFA
Synonyms VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor , VEGF; VEGF A; VPF; vascular permeability factor; VEGF; MVCD1; MGC70609;
Gene ID 7422
mRNA Refseq NM_001025366
Protein Refseq NP_001020537
MIM 192240
UniProt ID P15692

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VEGFA Products

Required fields are marked with *

My Review for All VEGFA Products

Required fields are marked with *

0
cart-icon
0
compare icon