Species : |
Rat |
Source : |
Human Cells |
Tag : |
Non |
Protein Length : |
33-254 a.a. |
Description : |
Rat Macrophage colony-stimulating factor 1(MCSF,CSF1) is a single-pass type I membrane cytokine. It is a hematopoietic growth factor that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. MCSF promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. It is involved in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development which for normal male and female fertility. It promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. MCSF also plays a role in lipoprotein clearance. |
Form : |
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 |
AA Sequence : |
EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMR FKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKD WNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQR TEGSSLLPSDLPLRIEDPGSAKQRPPR |
Endotoxin : |
Less than 0.1 ng/µg (1 IEU/µg). |
Purity : |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : |
Lyophilized protein should be stored at < -20ºC, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7ºC for 2-7 days. Aliquots of reconstituted samples are stable at < -20ºC for 3 months. |
Reconstitution : |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |