Active Recombinant Mouse Cxcl13 Protein

Cat.No. : Cxcl13-149M
Product Overview : Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 13 (Cxcl13) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Strongly chemotactic for B-lymphocytes, weakly for spleen monocytes and macrophages but no chemotactic activity for granulocytes. Binds to BLR1/CXCR5. May play a role in directing the migration of B-lymphocytes to follicles in secondary lymphoid organs.
Bio-activity : Determined by its ability to chemoattract murine B cells using a concentration of 10.0-100.0 ng/ml.
Molecular Mass : 9.8 kDa
AA Sequence : ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Cxcl13 chemokine (C-X-C motif) ligand 13 [ Mus musculus (house mouse) ]
Official Symbol Cxcl13
Synonyms Cxcl13; chemokine (C-X-C motif) ligand 13; BLC; Angie; BCA-1; BLR1L; ANGIE2; Scyb13; 4631412M08Rik; C-X-C motif chemokine 13; B lymphocyte chemoattractant; CXC chemokine BLC; small inducible cytokine subfamily B (Cys-X-Cys), member 13; small-inducible cytokine B13
Gene ID 55985
mRNA Refseq NM_018866
Protein Refseq NP_061354
UniProt ID O55038

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl13 Products

Required fields are marked with *

My Review for All Cxcl13 Products

Required fields are marked with *

0
cart-icon