Active Recombinant Mouse Cxcl13 Protein
| Cat.No. : | Cxcl13-149M |
| Product Overview : | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 13 (Cxcl13) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Description : | Strongly chemotactic for B-lymphocytes, weakly for spleen monocytes and macrophages but no chemotactic activity for granulocytes. Binds to BLR1/CXCR5. May play a role in directing the migration of B-lymphocytes to follicles in secondary lymphoid organs. |
| Bio-activity : | Determined by its ability to chemoattract murine B cells using a concentration of 10.0-100.0 ng/ml. |
| Molecular Mass : | 9.8 kDa |
| AA Sequence : | ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA |
| Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. |
| Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
| Gene Name | Cxcl13 chemokine (C-X-C motif) ligand 13 [ Mus musculus (house mouse) ] |
| Official Symbol | Cxcl13 |
| Synonyms | Cxcl13; chemokine (C-X-C motif) ligand 13; BLC; Angie; BCA-1; BLR1L; ANGIE2; Scyb13; 4631412M08Rik; C-X-C motif chemokine 13; B lymphocyte chemoattractant; CXC chemokine BLC; small inducible cytokine subfamily B (Cys-X-Cys), member 13; small-inducible cytokine B13 |
| Gene ID | 55985 |
| mRNA Refseq | NM_018866 |
| Protein Refseq | NP_061354 |
| UniProt ID | O55038 |
| ◆ Recombinant Proteins | ||
| CXCL13-08H | Active Recombinant Human CXCL13 Protein (Val23-Arg94), N-His tagged, Animal-free, Carrier-free | +Inquiry |
| CXCL13-50R | Recombinant Rat C-X-C motif chemokine ligand 13 Protein, His&SUMO tagged | +Inquiry |
| CXCL13-5240R | Recombinant Rat CXCL13 protein, GST-tagged | +Inquiry |
| CXCL13-131H | Recombinant Human CXCL13 Protein, His-tagged | +Inquiry |
| Cxcl13-79R | Recombinant Rat Cxcl13 Protein, His-GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL13-7170HCL | Recombinant Human CXCL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcl13 Products
Required fields are marked with *
My Review for All Cxcl13 Products
Required fields are marked with *



