Active Recombinant Mouse Cxcl13 Protein
Cat.No. : | Cxcl13-149M |
Product Overview : | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 13 (Cxcl13) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Strongly chemotactic for B-lymphocytes, weakly for spleen monocytes and macrophages but no chemotactic activity for granulocytes. Binds to BLR1/CXCR5. May play a role in directing the migration of B-lymphocytes to follicles in secondary lymphoid organs. |
Bio-activity : | Determined by its ability to chemoattract murine B cells using a concentration of 10.0-100.0 ng/ml. |
Molecular Mass : | 9.8 kDa |
AA Sequence : | ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Cxcl13 chemokine (C-X-C motif) ligand 13 [ Mus musculus (house mouse) ] |
Official Symbol | Cxcl13 |
Synonyms | Cxcl13; chemokine (C-X-C motif) ligand 13; BLC; Angie; BCA-1; BLR1L; ANGIE2; Scyb13; 4631412M08Rik; C-X-C motif chemokine 13; B lymphocyte chemoattractant; CXC chemokine BLC; small inducible cytokine subfamily B (Cys-X-Cys), member 13; small-inducible cytokine B13 |
Gene ID | 55985 |
mRNA Refseq | NM_018866 |
Protein Refseq | NP_061354 |
UniProt ID | O55038 |
◆ Recombinant Proteins | ||
CXCL13-1170C | Recombinant Cynomolgus C-X-C motif chemokine ligand 13 Protein, His&SUMO tagged | +Inquiry |
CXCL13-4101M | Recombinant Mouse CXCL13 protein, His-tagged | +Inquiry |
Cxcl13-2772H | Recombinant Hamster Cxcl13 Protein, His-tagged | +Inquiry |
CXCL13-024H | Active Recombinant Human CXCL13 Protein | +Inquiry |
CXCL13-2094M | Recombinant Mouse CXCL13 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL13-7170HCL | Recombinant Human CXCL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl13 Products
Required fields are marked with *
My Review for All Cxcl13 Products
Required fields are marked with *
0
Inquiry Basket