Recombinant Rat C-X-C motif chemokine ligand 13 Protein, His&SUMO tagged
Cat.No. : | CXCL13-50R |
Product Overview : | Recombinant Rat CXCL13 Protein (22-109aa) with N-His&SUMO tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 22-109aa |
Description : | Predicted to enable chemokine receptor binding activity; fibroblast growth factor binding activity; and heparin binding activity. Predicted to be involved in several processes, including cell chemotaxis; regulation of chemotaxis; and response to bacterium. Predicted to act upstream of or within lymph node development. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to human CXCL13 (C-X-C motif chemokine ligand 13). |
Tag : | N-His&SUMO |
Molecular Mass : | 24.2 kDa |
AA Sequence : | MNWSHPQFEKSSGSSGGHHHHHHGGSGGSGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQIGGILETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRSRSITSTPQAPVSKKRAA |
Purity : | > 85% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | 20 mM Tris-HCl, 0.10 M NaCl, pH8.0 |
Concentration : | 0.3 mg/mL |
Gene Name | Cxcl13 C-X-C motif chemokine ligand 13 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Cxcl13 |
Synonyms | CXCL13; chemokine (C-X-C motif) ligand 13; C-X-C motif chemokine 13 |
Gene ID | 498335 |
mRNA Refseq | NM_001017496 |
Protein Refseq | NP_001017496 |
UniProt ID | Q5I0J6 |
◆ Recombinant Proteins | ||
CXCL13-2161H | Recombinant Human CXCL13 Protein, GST-tagged | +Inquiry |
Cxcl13-149M | Active Recombinant Mouse Cxcl13 Protein | +Inquiry |
CXCL13-1169C | Recombinant Cynomolgus CXCL13 protein, His-tagged | +Inquiry |
CXCL13-4101M | Recombinant Mouse CXCL13 protein, His-tagged | +Inquiry |
Cxcl13-79R | Recombinant Rat Cxcl13 Protein, His-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL13-7170HCL | Recombinant Human CXCL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcl13 Products
Required fields are marked with *
My Review for All Cxcl13 Products
Required fields are marked with *