Active Recombinant Mouse Fgf1 Protein (140 aa)
Cat.No. : | Fgf1-403F |
Product Overview : | Recombinant mouse Fibroblast Growth Factor- acidic (rmFGF-acidic) produced in E. coli is a single non-glycosylated polypeptide chain containing 140 amino acids. A fully biologically active molecule, rmFGF-acidic has a molecular mass of 15.8 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 140 |
Description : | Fibroblast Growth Factor- acidic (FGF-acidic) is a mitogen targeting at the endothelial cells, and belongs to the heparin binding FGF family, which contains 22 members. FGF-acidic binds to the receptor family FGFR1-4 in vivo with the assistance of heparin. However, along with FGF -basic, FGF-acidic lacks the signal peptide segment, and thus is not secreted via endoplasmic reticulum (ER) and Golgi bodies. Studies have shown that FGF-acidic is highly regulated, and it is a direct angiogenesis factor. If unregulated, angiogenesis could contribute to several diseases including arthritis, diabetes, ocular neovascularization, and especially tumors. Therefore, FGF-acidic is treated as a potential oncogene, and its overexpression is correlated tightly with several cancers. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.4 ng/mL, measured by a cell proliferation assay using 3T3 cells in the presence of 10 μg/mL heparin, corresponding to a specific activity of > 2.5 × 10^6 units/mg. |
Molecular Mass : | 15.8 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant mouse Fibroblast Growth Factor- acidic (rmFGF-acidic) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-acidic should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Fgf1 fibroblast growth factor 1 [ Mus musculus (house mouse) ] |
Official Symbol | Fgf1 |
Synonyms | FGF1; fibroblast growth factor 1; AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha; fibroblast growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, alpha; endothelial cell growth factor, beta; fibroblast growth factor 1 (acidic); heparin-binding growth factor 1 |
Gene ID | 14164 |
mRNA Refseq | wwwcbilmihov/nuccore/NM_010197 |
Protein Refseq | wwwcbilmihov/protein/NP_034327 |
UniProt ID | P10935 |
◆ Recombinant Proteins | ||
FGF1-6736C | Recombinant Chicken FGF1 protein, His-tagged | +Inquiry |
Fgf1-057M | Active Recombinant Mouse Fgf1 Protein | +Inquiry |
FGF1-79M | Recombinant Mouse/Rat FGF1 Protein | +Inquiry |
FGF1-173H | Recombinant Human Fibroblast Growth Factor 1 (acidic, Sf9 Insect Cells Derived) | +Inquiry |
FGF1-8498H | Active Recombinant Human FGF1, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGF1-26203TH | Native Human FGF1 | +Inquiry |
FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF1-6252HCL | Recombinant Human FGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fgf1 Products
Required fields are marked with *
My Review for All Fgf1 Products
Required fields are marked with *
0
Inquiry Basket