Species : |
Mouse |
Source : |
E.coli |
Protein Length : |
140 |
Description : |
Fibroblast Growth Factor- acidic (FGF-acidic) is a mitogen targeting at the endothelial cells, and belongs to the heparin binding FGF family, which contains 22 members. FGF-acidic binds to the receptor family FGFR1-4 in vivo with the assistance of heparin. However, along with FGF -basic, FGF-acidic lacks the signal peptide segment, and thus is not secreted via endoplasmic reticulum (ER) and Golgi bodies. Studies have shown that FGF-acidic is highly regulated, and it is a direct angiogenesis factor. If unregulated, angiogenesis could contribute to several diseases including arthritis, diabetes, ocular neovascularization, and especially tumors. Therefore, FGF-acidic is treated as a potential oncogene, and its overexpression is correlated tightly with several cancers. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 0.4 ng/mL, measured by a cell proliferation assay using 3T3 cells in the presence of 10 μg/mL heparin, corresponding to a specific activity of > 2.5 × 10^6 units/mg. |
Molecular Mass : |
15.8 kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% by SDS-PAGE and HPLC analyses. |
Storage : |
Lyophilized recombinant mouse Fibroblast Growth Factor- acidic (rmFGF-acidic) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-acidic should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |