Active Recombinant Mouse Fgf1 Protein (140 aa)

Cat.No. : Fgf1-403F
Product Overview : Recombinant mouse Fibroblast Growth Factor- acidic (rmFGF-acidic) produced in E. coli is a single non-glycosylated polypeptide chain containing 140 amino acids. A fully biologically active molecule, rmFGF-acidic has a molecular mass of 15.8 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 140
Description : Fibroblast Growth Factor- acidic (FGF-acidic) is a mitogen targeting at the endothelial cells, and belongs to the heparin binding FGF family, which contains 22 members. FGF-acidic binds to the receptor family FGFR1-4 in vivo with the assistance of heparin. However, along with FGF -basic, FGF-acidic lacks the signal peptide segment, and thus is not secreted via endoplasmic reticulum (ER) and Golgi bodies. Studies have shown that FGF-acidic is highly regulated, and it is a direct angiogenesis factor. If unregulated, angiogenesis could contribute to several diseases including arthritis, diabetes, ocular neovascularization, and especially tumors. Therefore, FGF-acidic is treated as a potential oncogene, and its overexpression is correlated tightly with several cancers.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.4 ng/mL, measured by a cell proliferation assay using 3T3 cells in the presence of 10 μg/mL heparin, corresponding to a specific activity of > 2.5 × 10^6 units/mg.
Molecular Mass : 15.8 kDa, observed by reducing SDS-PAGE.
AA Sequence : FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant mouse Fibroblast Growth Factor- acidic (rmFGF-acidic) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-acidic should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Fgf1 fibroblast growth factor 1 [ Mus musculus (house mouse) ]
Official Symbol Fgf1
Synonyms FGF1; fibroblast growth factor 1; AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha; fibroblast growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, alpha; endothelial cell growth factor, beta; fibroblast growth factor 1 (acidic); heparin-binding growth factor 1
Gene ID 14164
mRNA Refseq wwwcbilmihov/nuccore/NM_010197
Protein Refseq wwwcbilmihov/protein/NP_034327
UniProt ID P10935

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Fgf1 Products

Required fields are marked with *

My Review for All Fgf1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon