Active Recombinant Mouse Il10 Protein
Cat.No. : | Il10-082M |
Product Overview : | Purified recombinant protein of Mouse interleukin 10 (Il10) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | This gene encodes an anti-inflammatory cytokine that is a member of the class-2 cytokine family. The encoded protein is secreted by cells of both the innate and adaptive immune systems and is crucial for limiting the immune response to a broad range of pathogens. It also has been shown to suppress autoimmune responses. This protein mediates it's immunosuppressive signal through a specific interleukin 10 receptor complex. Aberrant functioning of this gene is associated with numerous immune disorders including graft-versus-host disease, and increased susceptibility to HIV-1 infection and rheumatoid arthritis. |
Bio-activity : | The biological activity of murine IL-10 is measured by the dose-dependent co-stimulation (with IL-4) of the proliferation of murine MC/9 cells. The ED50 was found to be > 2 ng/ml, corresponding to a specific activity of > 5 x 10^5 units/mg. |
Molecular Mass : | 18.7 kDa |
AA Sequence : | MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGQKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLEDQGVYKAMNEFDIFINCIEAYMMIKMKS |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Il10 interleukin 10 [ Mus musculus (house mouse) ] |
Official Symbol | Il10 |
Synonyms | Il10; interleukin 10; CSIF; Il-10; interleukin-10; cytokine synthesis inhibitory factor |
Gene ID | 16153 |
mRNA Refseq | NM_010548 |
Protein Refseq | NP_034678 |
UniProt ID | P18893 |
◆ Recombinant Proteins | ||
IL10-492D | Recombinant Dog IL10 protein, His-tagged | +Inquiry |
IL10-2322R | Recombinant Rainbow trout IL10 protein, His&Myc-tagged | +Inquiry |
IL10-6743H | Recombinant Human IL10 protein, His-Avi-tagged, Biotinylated | +Inquiry |
IL10-110H | Recombinant Human Interleukin 10 | +Inquiry |
IL10-0021H | Recombinant Human IL10 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il10 Products
Required fields are marked with *
My Review for All Il10 Products
Required fields are marked with *
0
Inquiry Basket