Active Recombinant Mouse Il12a Protein, His-Tagged
| Cat.No. : | Il12a-01M |
| Product Overview : | Recombinant mouse Il12a Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Description : | Active IL-12 is a p70 disulfide-linked dimer composed of p35 and p40 subunits. The protein is a pleiotropic cytokine produced primarily by antigen presenting cells and has multiple effects on T lymphocytes and natural killer cells in terms of stimulating cytotoxicity, proliferation, production of other cytokines and Th1 subset differentiation. |
| Form : | Lyophilized powder |
| AA Sequence : | MRVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLM MTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINR VMGYLSSA with polyhistidine tag at the C-terminus |
| Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
| Bio-activity : | Measure by its ability to induce proliferation in T-cell enriched PBMC. The ED50 for this effect is <0.2 ng/mL. |
| Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Notes : | Please use within one month after protein reconstitution. |
| Gene Name | Il12a interleukin 12a [ Mus musculus (house mouse) ] |
| Official Symbol | Il12a |
| Synonyms | p35; Ll12a; Il-12a; IL-12p35 |
| Gene ID | 16159 |
| mRNA Refseq | NM_001159424.3 |
| Protein Refseq | NP_001152896.2 |
| UniProt ID | P43431 |
| ◆ Recombinant Proteins | ||
| Il12a-226M | Recombinant Mouse Interleukin 12a | +Inquiry |
| Il12a-6738M | Recombinant Mouse Il12a Protein (Met1-Ala215), C-His and C-TwinStrep tagged | +Inquiry |
| Il12a-227M | Recombinant Mouse Interleukin 12a, P40 | +Inquiry |
| IL12A-26973TH | Recombinant Human IL12A protein | +Inquiry |
| IL12A-4327HG | Active Recombinant Human IL12A protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL12A-001CCL | Recombinant Cynomolgus IL12A cell lysate | +Inquiry |
| IL12A-2435HCL | Recombinant Human IL12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il12a Products
Required fields are marked with *
My Review for All Il12a Products
Required fields are marked with *



