Active Recombinant Mouse Il12a Protein, His-Tagged
Cat.No. : | Il12a-01M |
Product Overview : | Recombinant mouse Il12a Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Active IL-12 is a p70 disulfide-linked dimer composed of p35 and p40 subunits. The protein is a pleiotropic cytokine produced primarily by antigen presenting cells and has multiple effects on T lymphocytes and natural killer cells in terms of stimulating cytotoxicity, proliferation, production of other cytokines and Th1 subset differentiation. |
Form : | Lyophilized powder |
AA Sequence : | MRVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLM MTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINR VMGYLSSA with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce proliferation in T-cell enriched PBMC. The ED50 for this effect is <0.2 ng/mL. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il12a interleukin 12a [ Mus musculus (house mouse) ] |
Official Symbol | Il12a |
Synonyms | p35; Ll12a; Il-12a; IL-12p35 |
Gene ID | 16159 |
mRNA Refseq | NM_001159424.3 |
Protein Refseq | NP_001152896.2 |
UniProt ID | P43431 |
◆ Recombinant Proteins | ||
IL12A-3025R | Recombinant Rat IL12A Protein | +Inquiry |
Il12a-210M | Recombinant Murine Interleukin 12a, P35-P40 | +Inquiry |
Il12a-226M | Recombinant Mouse Interleukin 12a | +Inquiry |
IL12A-315H | Recombinant Human IL12A protein(Met1-Ser219), His-tagged | +Inquiry |
Il12a-228M | Recombinant Mouse Interleukin 12a, P80 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12A-2435HCL | Recombinant Human IL12A cell lysate | +Inquiry |
IL12A-001CCL | Recombinant Cynomolgus IL12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il12a Products
Required fields are marked with *
My Review for All Il12a Products
Required fields are marked with *
0
Inquiry Basket