Active Recombinant Mouse Il17a Protein, His-Tagged

Cat.No. : Il17a-01M
Product Overview : Recombinant mouse Il17a Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Interleukin-17A is a protein that in humans is encoded by the IL17A gene. The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO).
Form : Lyophilized powder
AA Sequence : MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHM
NSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-17A is > 1 x 10^6 IU/mg.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Publications :
Gene Name Il17a interleukin 17A [ Mus musculus (house mouse) ]
Official Symbol Il17a
Synonyms Il17; Ctla8; IL-17; Ctla-8; IL-17A
Gene ID 16171
mRNA Refseq NM_010552.3
Protein Refseq NP_034682.1
UniProt ID Q60971

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il17a Products

Required fields are marked with *

My Review for All Il17a Products

Required fields are marked with *

0
cart-icon
0
compare icon