Active Recombinant Mouse Il17a Protein, His-Tagged
Cat.No. : | Il17a-01M |
Product Overview : | Recombinant mouse Il17a Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin-17A is a protein that in humans is encoded by the IL17A gene. The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). |
Form : | Lyophilized powder |
AA Sequence : | MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHM NSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-17A is > 1 x 10^6 IU/mg. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Publications : |
Oscilatory PEEP (BiPEEP) Improves Oxygenation and Reduces Inflammation in an Experimental Model of ARDS (2023)
|
Gene Name | Il17a interleukin 17A [ Mus musculus (house mouse) ] |
Official Symbol | Il17a |
Synonyms | Il17; Ctla8; IL-17; Ctla-8; IL-17A |
Gene ID | 16171 |
mRNA Refseq | NM_010552.3 |
Protein Refseq | NP_034682.1 |
UniProt ID | Q60971 |
◆ Recombinant Proteins | ||
IL17A-426H | Recombinant Human Interleukin 17A, His-tagged | +Inquiry |
IL17A-1588C | Active Recombinant Canine IL17A protein, His-tagged | +Inquiry |
IL17A-870H | Recombinant Human IL17A protein, His & T7-tagged | +Inquiry |
IL17A-572H | Active Recombinant Human Interleukin 17A, HIgG1 Fc-tagged | +Inquiry |
IL17A-1008P | Recombinant Pig IL17A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il17a Products
Required fields are marked with *
My Review for All Il17a Products
Required fields are marked with *