We use cookies to understand how you use our site and to improve the overall user experience. This includes
personalizing content and advertising. Read our Privacy Policy
Interleukin-17A is a protein that in humans is encoded by the IL17A gene. The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO).
Form :
Lyophilized powder
AA Sequence :
MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHM NSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA with polyhistidine tag at the C-terminus
Endotoxin :
<0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity :
Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-17A is > 1 x 10^6 IU/mg.
Purity :
>98% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer :
The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5.
Reconstitution :
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage :
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes :
Please use within one month after protein reconstitution.
Publications :
Oscilatory PEEP (BiPEEP) Improves Oxygenation and Reduces Inflammation in an Experimental Model of ARDS (2023)