Active Recombinant Mouse IL21 Protein

• Cat.No.: IL21-162M
• Product Overview: Recombinant Mouse IL21 Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Interleukin 21 (IL-21) is a member of the common-gamma chain family of cytokines that are involved in immunoregulation. IL-21 is normally expressed by activated CD4+ T cells and is aberrantly expressed in Hodgkin lymphoma cells. The IL-21 receptor (IL-21R) activates the JAK/STAT signaling pathway and is expressed on T, B, and natural killer (NK) cells. Within the B cell lineage, IL-21 is a switch factor regulating IgG1 and IgG3 antibody production. IL-21 also cooperates with IL-4 for the production of multiple antibody classes in B cells. IL-21 has pleiotropic effects on the proliferation, differentiation, and effector functions of B, T, NK, and dendritic cells.
• Bio-activity: B9 cell proliferation, ED50≤50 ng/mL
• AA Sequence: MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution:
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature

Gene Information

• Gene Name: Il21 interleukin 21 [ Mus musculus (house mouse) ]
• Official Symbol: IL21
• Synonyms: IL21; interleukin 21; interleukin-21; IL-21
• Gene ID: 60505
• mRNA Refseq: NM_021782
• Protein Refseq: NP_068554
• UniProt ID: Q9ES17