Active Recombinant Mouse Il21 Protein, His-Tagged

Cat.No. : Il21-01M
Product Overview : Recombinant mouse Il21 Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Interleukin-21 (IL21) belongs to the IL-15/IL-21 family. It is a cytokine with immunoregulatory activity. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response. They control many different cellular functions including proliferation, differentiation and cell survival/apoptosis but are also involved in several pathophysiological processes including viral infections and autoimmune diseases. Interleukin-21 is a cytokine that has potent regulatory effects on cells of the immune system, including natural killer (NK) cells and cytotoxic T cells that can destroy virally infected or cancerous cells. This cytokine induces cell division/proliferation in its target cells.
Form : Lyophilized powder
AA Sequence : MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQ
KHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is <6 ng/mL. The specific activity of recombinant mouse IL-21 is > 1.6 x 10^5 IU/mg.
Purity : >95% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Il21 interleukin 21 [ Mus musculus (house mouse) ]
Official Symbol Il21
Synonyms IL-21
Gene ID 60505
mRNA Refseq NM_001291041.1
Protein Refseq NP_001277970.1
UniProt ID A0A8C6GYE7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il21 Products

Required fields are marked with *

My Review for All Il21 Products

Required fields are marked with *

0
cart-icon
0
compare icon