Active Recombinant Mouse Il24 Protein, His-Tagged

Cat.No. : Il24-01M
Product Overview : Recombinant mouse Il24 Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Interleukin-24 (IL-24) is a cytokine belonging to the IL-10 family of cytokines that signals through two heterodimeric receptors: IL-20R1/IL-20R2 and IL-22R1/IL-20R2. This interleukin is also known as melanoma differentiation-associated 7 (mda-7) due to its discovery as a tumour suppressing protein. IL-24 appears to control in cell survival and proliferation by inducing rapid activation of particular transcription factors called STAT1 and STAT3. This cytokine is predominantly released by activated monocytes, macrophages and T helper 2 (Th2) cells and acts on non-haematopoietic tissues such as skin, lung and reproductive tissues. IL-24 performs important roles in wound healing, arthritis, psoriasis and cancer. Several studies have shown that cell death occurs in cancer cells/cell lines following exposure to IL-24. The gene for IL-24 is located on chromosome 1 in humans.
Form : Lyophilized powder
AA Sequence : MQEFRFGSCQVTGVVLPELWEAFWTVKNTVQTQDDITSIRLLKPQVLRNVSGAESCYLAHSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNF
IVIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVKAFGEVDILLTWMQKFYHL with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is <0.3 ng/mL.
Purity : >95% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Il24 interleukin 24 [ Mus musculus (house mouse) ]
Official Symbol Il24
Synonyms FISP; If2e; Mda7; St16; Mda-7
Gene ID 93672
mRNA Refseq NM_053095.3
Protein Refseq NP_444325.3
UniProt ID A0A087WQD7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il24 Products

Required fields are marked with *

My Review for All Il24 Products

Required fields are marked with *

0
cart-icon
0
compare icon