Active Recombinant Mouse Il34 Protein, His-Tagged
Cat.No. : | Il34-01M |
Product Overview : | Recombinant mouse Il34 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin-34 (IL-34) is a protein that promotes the proliferation, survival and differentiation of monocytes and macrophages. It also promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. IL-34 plays an important role in the regulation of osteoclast proliferation and differentiation, and in the regulation of bone resorption. Signaling via CSF1R and its downstream effectors stimulates phosphorylation of MAPK1/ERK2 AND MAPK3/ERK1. |
Form : | Lyophilized powder |
AA Sequence : | MNENLEIWTLTQDKECDLTGYLRGKLQYKNRLQYMKHYFPINYRIAVPYEGVLRVANITRLQKAHVSERELRYLWVLVSLNATESVMDVLLE GHPSWKYLQEVQTLLENVQRSLMDVEIGPHVEAVLSLLSTPGLSLKLVRPKALLDNCFRVMELLYCSCCKQSPILKWQDCELPRLHPHSPG SLMQCTATNVYPLSRQTPTSLPGSPSSSHGSLP with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is <30 ng/mL. The specific activity of recombinant mouse IL-34 is > 3.3 x 10^4 IU/mg. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il34 interleukin 34 [ Mus musculus (house mouse) ] |
Official Symbol | Il34 |
Synonyms | 2010004A03Rik |
Gene ID | 76527 |
mRNA Refseq | NM_001135100.2 |
Protein Refseq | NP_001128572.1 |
UniProt ID | Q8R1R4 |
◆ Recombinant Proteins | ||
Il34-1864H | Recombinant Mouse Il34 Protein, His-tagged | +Inquiry |
Il34-152M | Active Recombinant Mouse Il34 protein, His-tagged | +Inquiry |
Il34-1039M | Recombinant Mouse Il34 Protein, His-tagged | +Inquiry |
IL34-0400H | Recombinant Human IL34 Protein (Gly20-Pro242), C-His-tagged | +Inquiry |
Il34-194M | Recombinant Active Mouse IL34 Protein, His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL34-2783MCL | Recombinant Mouse IL34 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il34 Products
Required fields are marked with *
My Review for All Il34 Products
Required fields are marked with *