Active Recombinant Mouse Il36rn Protein, His-Tagged

Cat.No. : Il36rn-01M
Product Overview : Recombinant mouse Il36rn Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : As a result of the interaction of IL-36 ligands with the IL-1Rrp2 receptor. Various activities including dendritic cell maturation and activation are induced. IL-36RA can antagonize the NF-κB signaling through binding to the IL-1Rrp2 receptor by either IL-36α, β or γ in a way of preventing the initiation of functional signaling.
Form : Lyophilized powder
AA Sequence : MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKE
SKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to inhibit IL-36 gamma-induced IL-6 secretion in 3T3 cells. The ED50 for this effect is <2 μg/mL.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Il36rn interleukin 36 receptor antagonist [ Mus musculus (house mouse) ]
Official Symbol Il36rn
Synonyms Il1f5; If36rn; Il-1h3; Il1hy1; IL-36Ra; Fil1delta
Gene ID 54450
mRNA Refseq NM_001146087.1
Protein Refseq NP_001139559.1
UniProt ID Q9JIG2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il36rn Products

Required fields are marked with *

My Review for All Il36rn Products

Required fields are marked with *

0
cart-icon