Recombinant Full Length Human IL36RN Protein, GST-tagged

Cat.No. : IL36RN-5788HF
Product Overview : Human IL36RN full-length ORF ( NP_036407.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 155 amino acids
Description : The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq
Molecular Mass : 43.4 kDa
AA Sequence : MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IL36RN interleukin 36 receptor antagonist [ Homo sapiens ]
Official Symbol IL36RN
Synonyms IL36RN; interleukin 36 receptor antagonist; IL1F5, interleukin 1 family, member 5 (delta); interleukin-36 receptor antagonist protein; family of interleukin 1 delta; FIL1; FIL1(DELTA); FIL1D; IL 1 related protein 3; IL 1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; interleukin 1 HY1; interleukin 1 receptor antagonist homolog 1; MGC29840; IL-1ra homolog 1; interleukin-1 HY1; IL-1 related protein 3; interleukin-1-like protein 1; family of interleukin 1-delta; IL1F5 (Canonical product IL-1F5a); interleukin 1 family, member 5 (delta); interleukin-1 receptor antagonist homolog 1; IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta); IL1F5; PSORP;
Gene ID 26525
mRNA Refseq NM_012275
Protein Refseq NP_036407
MIM 605507
UniProt ID Q9UBH0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL36RN Products

Required fields are marked with *

My Review for All IL36RN Products

Required fields are marked with *

0
cart-icon
0
compare icon