Recombinant Full Length Human IL36RN Protein, GST-tagged
| Cat.No. : | IL36RN-5788HF |
| Product Overview : | Human IL36RN full-length ORF ( NP_036407.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 155 amino acids |
| Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq |
| Molecular Mass : | 43.4 kDa |
| AA Sequence : | MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | IL36RN interleukin 36 receptor antagonist [ Homo sapiens ] |
| Official Symbol | IL36RN |
| Synonyms | IL36RN; interleukin 36 receptor antagonist; IL1F5, interleukin 1 family, member 5 (delta); interleukin-36 receptor antagonist protein; family of interleukin 1 delta; FIL1; FIL1(DELTA); FIL1D; IL 1 related protein 3; IL 1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; interleukin 1 HY1; interleukin 1 receptor antagonist homolog 1; MGC29840; IL-1ra homolog 1; interleukin-1 HY1; IL-1 related protein 3; interleukin-1-like protein 1; family of interleukin 1-delta; IL1F5 (Canonical product IL-1F5a); interleukin 1 family, member 5 (delta); interleukin-1 receptor antagonist homolog 1; IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta); IL1F5; PSORP; |
| Gene ID | 26525 |
| mRNA Refseq | NM_012275 |
| Protein Refseq | NP_036407 |
| MIM | 605507 |
| UniProt ID | Q9UBH0 |
| ◆ Recombinant Proteins | ||
| Il36rn-3505M | Recombinant Mouse Il36rn Protein, Myc/DDK-tagged | +Inquiry |
| Il36rn-250M | Active Recombinant Mouse Il36rn Protein (Met2-Asp156), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| IL1F5-14169H | Recombinant Human IL1F5, His-tagged | +Inquiry |
| Il36rn-01M | Active Recombinant Mouse Il36rn Protein, His-Tagged | +Inquiry |
| IL1F5-316H | Active Recombinant Human IL1F5 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL36RN-5239HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
| IL36RN-5240HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL36RN Products
Required fields are marked with *
My Review for All IL36RN Products
Required fields are marked with *
