Active Recombinant Mouse Thpo Protein

Cat.No. : Thpo-6418M
Product Overview : Purified recombinant protein of Mouse thrombopoietin (Thpo), transcript variant 2 without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : This gene encodes a humoral growth factor necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. The encoded protein is a ligand for the product of the myeloproliferative leukemia virus oncogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
Bio-activity : The ED50 was determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be > 1.0 ng/mL, corresponding to a specific activity of > 1 × 10^6 units/mg.
Molecular Mass : 18.7 kDa
AA Sequence : SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF
Endotoxin : < 0.1 ng/μg of protein (< 1 EU/μg)
Purity : > 95% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2
Gene Name Thpo thrombopoietin [ Mus musculus (house mouse) ]
Official Symbol Thpo
Synonyms THPO; thrombopoietin; C-mpl ligand; megakaryocyte colony-stimulating factor; megakaryocyte growth and development factor; myeloproliferative leukemia virus oncogene ligand; Ml; Tpo; Mgdf; Tpo1; Tpo2; Tpo3; Tpo4; Mpllg
Gene ID 21832
mRNA Refseq NM_009379
Protein Refseq NP_033405
UniProt ID P40226

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Thpo Products

Required fields are marked with *

My Review for All Thpo Products

Required fields are marked with *

0

Inquiry Basket

cartIcon