Active Recombinant Mouse Thpo Protein
Cat.No. : | Thpo-6418M |
Product Overview : | Purified recombinant protein of Mouse thrombopoietin (Thpo), transcript variant 2 without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | This gene encodes a humoral growth factor necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. The encoded protein is a ligand for the product of the myeloproliferative leukemia virus oncogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Bio-activity : | The ED50 was determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be > 1.0 ng/mL, corresponding to a specific activity of > 1 × 10^6 units/mg. |
Molecular Mass : | 18.7 kDa |
AA Sequence : | SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Thpo thrombopoietin [ Mus musculus (house mouse) ] |
Official Symbol | Thpo |
Synonyms | THPO; thrombopoietin; C-mpl ligand; megakaryocyte colony-stimulating factor; megakaryocyte growth and development factor; myeloproliferative leukemia virus oncogene ligand; Ml; Tpo; Mgdf; Tpo1; Tpo2; Tpo3; Tpo4; Mpllg |
Gene ID | 21832 |
mRNA Refseq | NM_009379 |
Protein Refseq | NP_033405 |
UniProt ID | P40226 |
◆ Recombinant Proteins | ||
THPO-175H | Recombinant Human Thrombopoietin | +Inquiry |
THPO-269H | Active Recombinant Human Thrombopoietin | +Inquiry |
THPO-7258Z | Recombinant Zebrafish THPO | +Inquiry |
Thpo-575R | Recombinant Rat Thpo protein, His & T7-tagged | +Inquiry |
THPO-2752H | Recombinant Human THPO protein(22-353 aa), N-MBP & C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
THPO-2273CCL | Recombinant Cynomolgus THPO cell lysate | +Inquiry |
THPO-2831MCL | Recombinant Mouse THPO cell lysate | +Inquiry |
THPO-2832HCL | Recombinant Human THPO cell lysate | +Inquiry |
THPO-001HCL | Recombinant Human THPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Thpo Products
Required fields are marked with *
My Review for All Thpo Products
Required fields are marked with *