Active Recombinant Rat FGF2 Protein
Cat.No. : | FGF2-84R |
Product Overview : | Recombinant Rat FGF2 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Description : | Basic fibroblast growth factor (FGF-basic), also known as FGF-2, is expressed by endothelial cells and is a mediator of angiogenesis. FGF-basic also has cardioprotective functions during heart injury. FGF-basic binds heparin in order to signal through fibroblast growth factor (FGF) receptor tyrosine kinases. |
Bio-activity : | 3T3 proliferation, ≤1 ng/mL |
Molecular Mass : | Monomer, 16.4 kDa (146 aa) |
AA Sequence : | MPALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mm sodium phosphate, 50 mM sodium chloride, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Fgf2 fibroblast growth factor 2 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | FGF2 |
Synonyms | FGF2; fibroblast growth factor 2; HBGF-2; basic fibroblast growth factor; heparin-binding growth factor 2; bFGF; Fgf-2; |
Gene ID | 54250 |
mRNA Refseq | NM_019305 |
Protein Refseq | NP_062178 |
UniProt ID | P13109 |
◆ Recombinant Proteins | ||
FGF2-6755R | Recombinant Rabbit FGF2 protein, His-SUMO-tagged | +Inquiry |
Fgf2-543M | Recombinant Mouse Fgf2 protein, His-tagged | +Inquiry |
Fgf2-7206M | Active Recombinant Mouse Fgf2 Protein | +Inquiry |
FGF2-650B | Recombinant Bovine Fibroblast Growth Factor 2 | +Inquiry |
FGF2-57H | Recombinant Human fibroblast growth factor 2 (basic) Protein, HA tagged | +Inquiry |
◆ Native Proteins | ||
FGF2-26551TH | Native Human FGF2 | +Inquiry |
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *
0
Inquiry Basket