Active Recombinant Rat TNF Protein
Cat.No. : | TNF-251R |
Product Overview : | Recombinant Rat TNF Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Description : | Tumor necrosis factor alpha (TNF-α) is an inflammatory cytokine secreted by macrophages, monocytes, neutrophils, T cells, and NK-cells following stimulation by bacterial lipopolysaccharide (LPS). TNF-α signal activation occurs through two receptors, TNFR1 and TNFR2. TNFR1 is expressed on most cell types, unlike TNFR2, which is expressed mainly on immune cells. TNF-α functions to stimulate phagocytosis in macrophages, chemoattract neutrophils, increase insulin resistance, and induce fever. |
Bio-activity : | Cytolysis of mouse L929 cells in the presence of Actinomycin D, ≤50 pg/mL |
Molecular Mass : | Monomer, 17.3 kDa (157 aa) |
AA Sequence : | MLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFATSYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVSQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Tnf tumor necrosis factor [ Rattus norvegicus (Norway rat) ] |
Official Symbol | TNF |
Synonyms | TNF; tumor necrosis factor; cachectin; tumor necrosis factor alpha; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor ligand superfamily member 2; Tnfa; RATTNF; TNF-alpha; MGC124630; |
Gene ID | 24835 |
mRNA Refseq | NM_012675 |
Protein Refseq | NP_036807 |
UniProt ID | P16599 |
◆ Recombinant Proteins | ||
TNF-531H | Recombinant Human TNF Protein | +Inquiry |
TNF-1914H | Recombinant Human Tumor Necrosis Factor, HQ-tagged | +Inquiry |
TNF-6471H | Recombinant Human TNF Protein (Gly57-Leu233), N-His tagged | +Inquiry |
TNF-5722D | Recombinant Dog TNF protein, rFc-tagged | +Inquiry |
TNF-303T | Active Recombinant Rhesus Macaque TNF Protein (157 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNF Products
Required fields are marked with *
My Review for All TNF Products
Required fields are marked with *