"IL3" Related Products

Expand
Expand

Recombinant Human IL3 protein

Cat.No. : IL3-08H
Product Overview : Recombinant Human IL3 protein was expressed in Escherichia coli.
Description : Interleukin-3 (IL-3) is an interleukin, a type of biological signal (cytokine) which is encoded by the IL-3 gene located on chromosome 5 and produced primarily by activated T cells beside human thymic epithelial cells, activated murine mast cells, murine keratinocytes and neurons/astrocytes. The protein acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. The human IL-3 reported to be a monomer, as it is known, contains 133 amino acids residues which is a single non-glycosylated polypeptide. Specifically, human and murine IL-3 share low homology and it does not show activity on murine cells.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁷ IU/mg.
Molecular Mass : Approximately 15.0 kDa, a single non-glycosylated polypeptide chain containing 133 amino acids.
Protein length : 133
AA Sequence : APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Endotoxin : Less than 1 EU/µg of rHuIL-3 as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
SDS-PAGE of IL3-08H :

Gene Name : IL3
Official Symbol : IL3
Synonyms : IL3; interleukin 3 (colony-stimulating factor, multiple); interleukin-3; hematopoietic growth factor; IL 3; mast cell growth factor; MCGF; MGC79398; MGC79399; MULTI CSF; multilineage colony stimulating factor; P cell stimulating factor; mast-cell growth factor; P-cell stimulating factor; P-cell-stimulating factor; multilineage-colony-stimulating factor; multipotential colony-stimulating factor; IL-3; MULTI-CSF;
Gene ID : 3562
mRNA Refseq : NM_000588
Protein Refseq : NP_000579
MIM : 147740
UniProt ID : P08700

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.