Recombinant Human GPX8, His-tagged GPX8-96H

Recombinant Human GPX8, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human GPX8, His-tagged

Recombinant Human GPX8, His-tagged

GPX8 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : GPX8-96H
Product Overview : Recombinant Human Probable Glutathione Peroxidase 8/GPX8 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Leu209) of Human GPX8 fused with a polyhistidine tag at the C-terminus.
Description : Probable Glutathione Peroxidase 8 (GPX8) is a member of the glutathione peroxidase family. GPX8 is a single-pass membrane protein and catalysis glutathione into glutathione disulfide. It is shown that GPX8 interacts with 17alpha-ethynylestradiol, diuron and 2-butoxyethanol (ortholog). In addition, GPX8 is involved in response to oxidative stress.
Source : HEK293
Species : Human
Tag : His
AA Sequence : MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTV SLEK YKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSK EVESFARK NYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKF WKPEEPIEVIRP DIAALVRQVIIKKKEDLVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name : GPX8 glutathione peroxidase 8 (putative) [ Homo sapiens ]
Official Symbol : GPX8
Synonyms : GPX8; glutathione peroxidase 8 (putative); probable glutathione peroxidase 8; EPLA847; UNQ847; GPx-8; GSHPx-8;
Gene ID : 493869
mRNA Refseq : NM_001008397
Protein Refseq : NP_001008398
UniProt ID : Q8TED1
Chromosome Location : 5q11.2
Pathway : glutathione redox reactions I, organism-specific biosystem;
Function : glutathione peroxidase activity; oxidoreductase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy