"GPX8" Related Products

Recombinant Human GPX8, His-tagged

Cat.No.: GPX8-96H
Product Overview: Recombinant Human Probable Glutathione Peroxidase 8/GPX8 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Leu209) of Human GPX8 fused with a polyhistidine tag at the C-terminus.
Description: Probable Glutathione Peroxidase 8 (GPX8) is a member of the glutathione peroxidase family. GPX8 is a single-pass membrane protein and catalysis glutathione into glutathione disulfide. It is shown that GPX8 interacts with 17alpha-ethynylestradiol, diuron and 2-butoxyethanol (ortholog). In addition, GPX8 is involved in response to oxidative stress.
Source: HEK293
Species: Human
Tag: His
AA Sequence: MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTV SLEK YKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSK EVESFARK NYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKF WKPEEPIEVIRP DIAALVRQVIIKKKEDLVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: GPX8 glutathione peroxidase 8 (putative) [ Homo sapiens ]
Official Symbol: GPX8
Synonyms: GPX8; glutathione peroxidase 8 (putative); probable glutathione peroxidase 8; EPLA847; UNQ847; GPx-8; GSHPx-8;
Gene ID: 493869
mRNA Refseq: NM_001008397
Protein Refseq: NP_001008398
UniProt ID: Q8TED1
Chromosome Location: 5q11.2
Pathway: glutathione redox reactions I, organism-specific biosystem;
Function: glutathione peroxidase activity; oxidoreductase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.