"Ccl3" Related Products

Expand
Expand

Recombinant Rat Ccl3 protein

Cat.No. : Ccl3-56R
Product Overview : Recombinant Rat Ccl3 protein was expressed in Escherichia coli.
Description : This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5.
Source : E.coli
Species : Rat
Form : Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemoattract bioassay using human blood monocytes is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids.
Protein length : 69
AA Sequence : APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA
Endotoxin : Less than 0.1 EU/µg of rRtMIP-1α/CCL3 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : Ccl3
Official Symbol : Ccl3
Synonyms : CCL3; chemokine (C-C motif) ligand 3; C-C motif chemokine 3; MIP-1-alpha; small inducible cytokine A3; small-inducible cytokine A3; macrophage inflammatory protein 1-alpha; Macrophage inflammatory protein 1 alpha (Small inducible cytokine A3); Scya3; MIP-1a;
Gene ID : 25542
mRNA Refseq : NM_013025
Protein Refseq : NP_037157
UniProt ID : P50229

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.