"IL5" Related Products

Expand
Expand

Recombinant Canine IL-5

Cat.No.: IL5-27C
Product Overview: Canine IL-5 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.
Description: IL-3, IL-5, and GM-CSF are important in regulating eosinophil development. Of these three cytokines, IL-5 is the most specific to the eosinophil lineage and is responsible for selective terminal differentiation of eosinophils. The IL-5 receptor is composed of an alpha and a beta-common chain. The alpha subunit is specific for the IL-5 molecule, whereas the beta-common subunit also recognized by IL-3 and GM-CSF. IL-5 is produced by both hematopoietic and non-hematopoietic cells including T cells, granulocytes, and natural helper cells. It is associated with the cause of several allergic diseases including allergic rhinitis and asthma.
Source: Yeast
Species: Canine
Form: Lyophilized
Molecular Mass: 13.1 kDa
AA Sequence: VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKE HIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES
Applications: The Canine IL-5 protein can be used in cell culture, as an IL-5 ELISA Standard, and as a Western Blot Control.
Storage: -20 C

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.