"CAPN2" Related Products

Expand
Expand

Recombinant Human CAPN2, His-tagged

Cat.No.: CAPN2-122H
Product Overview: Recombinant Human Calpain-2 Catalytic Subunit/CAPN2 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Leu700) of Human CAPN2 fused with a 6His tag at the C-terminus.
Description: The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 2. Multiple heterogeneous transcriptional start sites in the 5' UTR have been reported. Two transcript variants encoding different isoforms have been found for this gene.
Source: E. coli
Species: Human
Tag: His
Form: Supplied as a 0.2 μM filtered solution of PBS, 50% Glycerol, 2mM DTT, pH 7.4
AA Sequence: MAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGFKELGP YSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPLNQS FQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEAL SGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGCSIDITSAADSEAITFQKLVK GHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDNCPSWNTIDPEERERLTRRHEDGEFW MSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIK LEEEDEDEEDGESGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLT NRARERSDTFINLREVLNRFKLPPGEYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANL EEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLD SDGSGKLGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARF ADDQLIIDFDNFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVLVEHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Gene Name: CAPN2 calpain 2, (m/II) large subunit [ Homo sapiens (human) ]
Official Symbol: CAPN2
Synonyms: CAPN2; calpain 2, (m/II) large subunit; calpain-2 catalytic subunit; CANPL2; CANPml; mCANP; CANP 2; M-calpain; calpain M-type; millimolar-calpain; calpain-2 large subunit; calpain 2, large subunit; calpain large polypeptide L2; calpain, large polypeptide L2; calpain 2, large [catalytic] subunit; calcium-activated neutral proteinase 2; CANP2; FLJ39928
Gene ID: 824
mRNA Refseq: NM_001146068
Protein Refseq: NP_001139540
MIM: 114230
UniProt ID: P17655
Chromosome Location: 1q41-q42
Pathway: Alzheimers Disease; ErbB1 downstream signaling; Protein processing in endoplasmic reticulum
Function: calcium ion binding; calcium-dependent cysteine-type endopeptidase activity; cysteine-type peptidase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.