Active Recombinant Human MSLN, His-tagged, Biotinylated
| Cat.No. : | MSLN-642H |
| Product Overview : | The recombinant human MSLN is expressed as a 317-amino acid protein consisting of Glu296 - Ser592 region of MSLN (UniProt accession #Q13421, isoform 2) and a C-terminal His-tag. It contains 4 potential N-linked glycosylation sites. |
| Availability | January 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | His |
| Protein Length : | 296-592 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Binds to CA125/MUC16 and anti-MSLN monoclonal antibody, human IgG1 with high affinity KD< 5 nM as measured by ELISA. |
| Molecular Mass : | Calculated molecular mass (kDa): 35.9; Estimated by SDS-PAGE under reducing condition (kDa): 48-50 |
| AA Sequence : | EVEKTACPSGKKAREIDESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDELYPQGYPESVIQ HLGYLFLKMSPEDIRKWNVTSLETLKALLEVNKGHEMSPQVATLIDRFVKGRGQLDKDTLDTLTAFYPGYLCSL SPEELSSVPPSSIWAVRPQDLDTCDPRQLDVLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSM DLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLS TTENLYFQGSTGHHHHHHHH |
| Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
| Purity : | >90% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | MSLN mesothelin [ Homo sapiens ] |
| Official Symbol | MSLN |
| Synonyms | MSLN; mesothelin; CAK1; MPF; CAK1 antigen; megakaryocyte potentiating factor; soluble MPF mesothelin related protein; pre-pro-megakaryocyte-potentiating factor; SMRP; |
| Gene ID | 10232 |
| mRNA Refseq | NM_001177355 |
| Protein Refseq | NP_001170826 |
| MIM | 601051 |
| UniProt ID | Q13421 |
| Chromosome Location | 16p13.3 |
| ◆ Recombinant Proteins | ||
| MSLN-15H | Active Recombinant Human MSLN Protein, His-tagged, Alexa Fluor® 488 conjugated | +Inquiry |
| MSLN-5659H | Recombinant Human MSLN Protein, GST-tagged | +Inquiry |
| MSLN-0383R | Active Recombinant Rat MSLN protein, His-tagged | +Inquiry |
| MSLN-340H | Recombinant Human MSLN protein, Fc-tagged | +Inquiry |
| MSLN-3449R | Recombinant Rat MSLN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MSLN-1316HCL | Recombinant Human MSLN cell lysate | +Inquiry |
| MSLN-1343HCL | Recombinant Human MSLN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSLN Products
Required fields are marked with *
My Review for All MSLN Products
Required fields are marked with *
