Recombinant Human MSLN, His-tagged, Biotinylated MSLN-642H

Recombinant Human MSLN, His-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human MSLN, His-tagged, Biotinylated

Recombinant Human MSLN, His-tagged, Biotinylated

MSLN Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : MSLN-642H
Product Overview : The recombinant human MSLN is expressed as a 317-amino acid protein consisting of Glu296 - Ser592 region of MSLN (UniProt accession #Q13421, isoform 2) and a C-terminal His-tag. It contains 4 potential N-linked glycosylation sites.
Source : Human cells
Species : Human
Tag : His
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds to CA125/MUC16 and anti-MSLN monoclonal antibody, human IgG1 with high affinity KD< 5 nM as measured by ELISA.
Molecular Mass : Calculated molecular mass (kDa): 35.9; Estimated by SDS-PAGE under reducing condition (kDa): 48-50
AA Sequence : EVEKTACPSGKKAREIDESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDELYPQGYPESVIQ HLGYLFLKMSPEDIRKWNVTSLETLKALLEVNKGHEMSPQVATLIDRFVKGRGQLDKDTLDTLTAFYPGYLCSL SPEELSSVPPSSIWAVRPQDLDTCDPRQLDVLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSM DLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLS TTENLYFQGSTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >90% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : MSLN mesothelin [ Homo sapiens ]
Official Symbol : MSLN
Synonyms : MSLN; mesothelin; CAK1; MPF; CAK1 antigen; megakaryocyte potentiating factor; soluble MPF mesothelin related protein; pre-pro-megakaryocyte-potentiating factor; SMRP;
Gene ID : 10232
mRNA Refseq : NM_001177355
Protein Refseq : NP_001170826
MIM : 601051
UniProt ID : Q13421
Chromosome Location : 16p13.3

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy