"CCL22" Related Products

Expand
Expand
Expand

Recombinant Human CCL22, 69aa

Cat. No.: CCL22-67H
Product Overview: Recombinant Human chemokine (C-C motif) ligand 22 was expressed inE. Coli.
Description: Human Macrophage-Derived Chemokine (MDC) is a unique member of the CC chemokine family. Human MDC is highly expressed in macrophages and in monocyte-derived dendritic cells, but not in monocytes, natural killer cells, or several cell lines of epithelial, endothelial or fibroblast origin. This recombinant version is a peptide of 8.1 kDa that consists of 69 amino acid residues, which contains a glycine and proline at the N-terminus.
Source: E. Coli.
Amino Acid Sequence: GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLL TFRDKEICA D P RVPWV KMILNKLSQ.
Supplied: Lyophilized powder with no additives.
Purity: >98% by SDS-Page and HPLC analysis Endotoxin level is less than 0.1ng per ug (1EU/mg) of MDC.
Reactivity: The reactivity of this rhuman MDC was determined by a chemotaxis assay using human T cells. Significant chemotaxis was achieved using a concentration of 10-100ng/ml.
Note: If this material is not to be used for coating or labeling (or other applications requiring carrier free material), the addition of 0.1% BSA to dilution buffers or dilution in sterile culture media is recommended to enhance stability and minimize absorption to vial. Ideally, maintain stock >50ug/ml.
Reconstitution: The lyophilized MDC should be reconstituted in water to a concentration of 0.1-1.0mg/ml. Allow to set at least 30 minutes at 4°C, tighten cap and rotate to reconstitute any material on sides of vial. If desired, you can centrifuge at 1000 rpm for 1 minute to concentrate volume in bottom of vial. This solution can be diluted into other buffered solutions containing carrier protein or medium and stored at 4°C for up to 1 week or at -20 °C for future use.
Storage: The lyophilized powder is stable at room temperature for several weeks but it is best stored desiccated at -20°C. Reconstituted MDC should be stored in working aliquots at -20°C. avoid frequent freeze thaw cycles.
Gene Name: CCL22 chemokine (C-C motif) ligand 22 [ Homo sapiens ]
Synonyms: chemokine (C-C motif) ligand 22; MDC; ABCD-1; SCYA22; STCP-1; DC/B-CK; MGC34554; A-152E5.1; CCL22; small inducible cytokine A22; CC chemokine STCP-1; macrophage-derived chemokine; stimulated T cell chemotactic protein 1; small inducible cytokine subfamily A (Cys-Cys), member 22; Macrophage-derived chemokine; Small-inducible cytokine A22; Stimulated T-cell chemotactic protein 1; MDC(1-69)
Gene ID: 6367
mRNA Refseq: NM_002990
Protein Refseq: NP_002981
MIM: 602957
UniProt ID: O00626
Chromosome Location: 16q13
Pathway: Chemokine signaling pathway; Cytokine-cytokine receptor interaction
Function: chemokine activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.