Recombinant Mouse CCL22 Protein

Cat.No. : CCL22-2887M
Product Overview : Fractalkine Mouse Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 76 amino acids and having a molecular mass of 8.7 kDa. The CX3CL1 is purified by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Fractalkine soluble form is chemotactic for t-cells and monocytes, but not for neutrophils. Fractalkine membrane-bound form promotes adhesion of those leukocytes to endothelial cells. Fractalkine regulates leukocyte adhesion and migration processes at the endothelium and binds to CX3CR1. Natural Human Fractalkine is produced as a long protein (373-amino acid) with an extended mucin-like stalk and a chemokine domain on top. The mucin-like stalk permits it to bind to the cell surface. Fractalkine gene is located on human chromosome 16 along with some CC chemokines known as CCL17 and CCL22.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : The ED50 as determined by a cell proliferation assay using human peripheral blood lymphocytes (PBL) is less than 0.5 μg/mL, corresponding to a specific activity of > 2000 IU/mg.
Molecular Mass : 8.7 kDa
AA Sequence : QHLGMTKCEIMCGKMTSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFCADPKEKWVQDAMKHLDHQAAALTKNG.
Purity : Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Stability : Lyophilized CX3CL1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution CX3CL1 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Usage : Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Storage Buffer : Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Shipping : Shipped at Room temp.
Reconstitution : It is recommended to reconstitute the lyophilized CX3CL1 in sterile 18MΩ-cm H2O not less than 100 μg/mL, which can then be further diluted to other aqueous solutions.
Gene Name Ccl22 chemokine (C-C motif) ligand 22 [ Mus musculus ]
Official Symbol CCL22
Synonyms CCL22; chemokine (C-C motif) ligand 22; C-C motif chemokine 22; CC chemokine ABCD-1; small-inducible cytokine A22; activated B and dendritic cell-derived; small inducible cytokine subfamily A22; dendritic cell and B cell derived chemokine; small inducible cytokine subfamily A, member 22; SMALL INDUCIBLE CYTOKINE A22 PRECURSOR (CC CHEMOKINE ABCD-1) (ACTIVATED B AND DENDRITIC CELL-DERIVED); MDC; DCBCK; ABCD-1; Scya22;
Gene ID 20299
mRNA Refseq NM_009137
Protein Refseq NP_033163
UniProt ID O88430

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL22 Products

Required fields are marked with *

My Review for All CCL22 Products

Required fields are marked with *

0
cart-icon
0
compare icon