"NPM1" Related Products

Expand
Expand
Expand

Recombinant Human NPM1, GST-tagged

Cat. No. : NPM1-1417H
Product Overview : Recombinant full-length human NPM1( AAH02398.1, 1 a.a. - 295 a.a.) protein was expressed with a GST tag. MW = 58.450001 kDa (528 aa).
Description : NPM1 is associated with nucleolar ribonucleoprotein structures and bind single-stranded nucleic acids. It may be involved in the assembly and/or transport of ribosome. Its regulation through SUMOylation (by SENP3 and SENP5) is another facet of the proteins"s regulation and cellular functions. It is located in nucleolus, but it can be translocated to the nucleoplasm in case of serum starvation or treatment with anticancer drugs. The protein is phosphorylated.
Protein Sequence : MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Applications : Enzyme-linked immunoabsorbent assay,Western Blot (Recombinant protein),Antibody Production,Protein Array.
Quality Control Testing : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein.
Gene Name : NPM1 nucleophosmin (nucleolar phosphoprotein B23, numatrin) [ Homo sapiens ]
Synonyms : NPM1; nucleophosmin (nucleolar phosphoprotein B23, numatrin); B23; NPM; MGC104254; nucleophosmin 1; numatrin; nucleophosmin/nucleoplasmin family, member 1; Nucleolar protein NO38;Nucleolar phosphoprotein B23
Gene ID : 4869
mRNA Refseq : NM_001037738
Protein Refseq : NP_001032827
MIM : 164040
UniProt ID : P06748
Chromosome Location : 5q35
Function : NF-kappaB binding; Tat protein binding; histone binding; protein heterodimerization activity; protein homodimerization activity; rRNA binding; ribosomal large subunit binding; ribosomal small subunit binding; transcription coactivator activity; unfolded protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.