Recombinant Human AP1S1

Cat.No. : AP1S1-27354TH
Product Overview : Recombinant full length Human AP1S1 isoform 2 with a N terminal proprietary tag; Predicted MWt 40.74 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 133 amino acids
Description : The protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle.
Molecular Weight : 40.740kDa inclusive of tags
Tissue specificity : Widely expressed.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MMRFMLLFSRQGKLRLRKWYLATSDKERKKMVRELMQVVL ARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELIT LELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMG GDVQDTSTFPFSH
Sequence Similarities : Belongs to the adaptor complexes small subunit family.
Gene Name AP1S1 adaptor-related protein complex 1, sigma 1 subunit [ Homo sapiens ]
Official Symbol AP1S1
Synonyms AP1S1; adaptor-related protein complex 1, sigma 1 subunit; CLAPS1; AP-1 complex subunit sigma-1A; AP 1 complex subunit sigma 1A; AP19; clathrin assembly protein complex 1 sigma 1A small chain; clathrin coat assembly protein AP19; clathrin associated/assem
Gene ID 1174
mRNA Refseq NM_001283
Protein Refseq NP_001274
MIM 603531
Uniprot ID P61966
Chromosome Location 7
Pathway Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; HIV Infection, organism-specific biosystem; Host Interactions of HIV factors, organism-specific biosystem; Lysosome, organism-specific biosystem;
Function protein transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AP1S1 Products

Required fields are marked with *

My Review for All AP1S1 Products

Required fields are marked with *

0
cart-icon
0
compare icon