Recombinant Human AP1S1
Cat.No. : | AP1S1-27354TH |
Product Overview : | Recombinant full length Human AP1S1 isoform 2 with a N terminal proprietary tag; Predicted MWt 40.74 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle. |
Protein length : | 133 amino acids |
Molecular Weight : | 40.740kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Widely expressed. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MMRFMLLFSRQGKLRLRKWYLATSDKERKKMVRELMQVVL ARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELIT LELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMG GDVQDTSTFPFSH |
Sequence Similarities : | Belongs to the adaptor complexes small subunit family. |
Gene Name : | AP1S1 adaptor-related protein complex 1, sigma 1 subunit [ Homo sapiens ] |
Official Symbol : | AP1S1 |
Synonyms : | AP1S1; adaptor-related protein complex 1, sigma 1 subunit; CLAPS1; AP-1 complex subunit sigma-1A; AP 1 complex subunit sigma 1A; AP19; clathrin assembly protein complex 1 sigma 1A small chain; clathrin coat assembly protein AP19; clathrin associated/assem |
Gene ID : | 1174 |
mRNA Refseq : | NM_001283 |
Protein Refseq : | NP_001274 |
MIM : | 603531 |
Uniprot ID : | P61966 |
Chromosome Location : | 7 |
Pathway : | Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; HIV Infection, organism-specific biosystem; Host Interactions of HIV factors, organism-specific biosystem; Lysosome, organism-specific biosystem; |
Function : | protein transporter activity; |
Products Types
◆ Recombinant Protein | ||
AP1S1-598M | Recombinant Mouse AP1S1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AP1S1-184H | Recombinant Human AP1S1 Protein, His-tagged | +Inquiry |
AP1S1-1735M | Recombinant Mouse AP1S1 Protein | +Inquiry |
Ap1s1-3529M | Recombinant Mouse Ap1s1, His-tagged | +Inquiry |
AP1S1-649H | Recombinant Human AP1S1 protein, GST-tagged | +Inquiry |
◆ Lysates | ||
AP1S1-8817HCL | Recombinant Human AP1S1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket